DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG33795

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:182 Identity:77/182 - (42%)
Similarity:119/182 - (65%) Gaps:15/182 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIVLVI------WMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNV 59
            :|||:::      |.|::|         |.:|:||.:||:.|:|||....|||:||:||:...|.
  Fly     5 LKIVVILVTFLLTWRLSYS---------VTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNF 60

  Fly    60 DANLLHPVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRRRNNALIRIVWELFKEYSTINHTCP 124
            :|.:.||.:||::..|.|||.||||||||..:.|||:|:|:..:.|.::::.:||.:|.||||||
  Fly    61 NATIHHPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCP 125

  Fly   125 YVGLQQVKNFYLRSEKLPTPIPTGEYLLMIDWVFNKKPQAATNVYFTFVEDL 176
            :.|...::..|||:|....|.|:|:|:|.|:|.|.||.|..||:.:.|:|:|
  Fly   126 FYGDILIRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDFIENL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 39/89 (44%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 35/75 (47%)

Return to query results.
Submit another query.