DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG33626

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027405.2 Gene:CG33626 / 3772257 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster


Alignment Length:129 Identity:29/129 - (22%)
Similarity:55/129 - (42%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CRLRAVSRNKVCLNVDANLLHPVHDVIVKARL---LKRANGYKPWLYSVSFDGCQFIRRR-NNAL 105
            |::....|:  .|||:..||..:..:.|..::   .|....|:.: :.::||||:.|... ...:
  Fly    37 CQIGGTRRS--LLNVELKLLTELDQIKVYIKISTRFKSTTLYRKF-FDITFDGCRVISDMVQGTM 98

  Fly   106 IRIVWELFKEYSTINHTCPY-VGLQQVKNFYLRSEKLPTPIPTGEYLLMIDWVFNKKPQAATNV 168
            :..::....:.|.....||. .|.....|..: .:.||..:|:.:..:.||  |..:.|...||
  Fly    99 VSNMFNAVVKSSNQPRKCPVNKGTIYYHNISI-EDALPMFVPSAQLFIQID--FYARRQLYLNV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 20/88 (23%)
CG33626NP_001027405.2 DUF1091 76..153 CDD:472716 17/80 (21%)

Return to query results.
Submit another query.