DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG33798

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:162 Identity:49/162 - (30%)
Similarity:98/162 - (60%) Gaps:12/162 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWL 87
            :.::||..||:.::::.:|..|||::|:|....:::..:|.. ||:.:.|...:.||.|||||:|
  Fly    20 LVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQIKVNTAIYKRLNGYKPFL 84

  Fly    88 YSVSFDGCQFIRRRN-NALIRIVWELFKEYSTINHTCPY---VGLQQVK----NFYLRSEKLPTP 144
            |:|:.|||:||:.:| |.:.:.::.:||:.:.:||:|||   :.::::.    ||.:  .|: .|
  Fly    85 YNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEKLSAESINFQI--TKI-LP 146

  Fly   145 IPTGEYLLMIDWVFNKKPQAATNVYFTFVEDL 176
            .|.|:|::.::|......:|...:|.|....:
  Fly   147 FPEGKYMVKMNWFAYDINRAIIRLYITLTNSI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 31/97 (32%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:461928 32/87 (37%)

Return to query results.
Submit another query.