DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG33647

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:154 Identity:34/154 - (22%)
Similarity:58/154 - (37%) Gaps:10/154 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVH 68
            :||..:|...:....:.:..:| ||...|..|....|....|.|...|.....:..:..|...|.
  Fly     8 ILVDLILGTLILSSVRAEKEVF-MTKIECLNYMPELVRNVSCYLNETSHPTGSIYAEFILTQDVE 71

  Fly    69 DVIVKARLLKRANGYKPWLYSVSFDGCQFIRR-RNNALIRIVWELFKEYSTINHTCPYVGLQQVK 132
            |:.....|..:...|.....|...|.||.:.. .|:.|.|:|....:|.:.....||   |:..|
  Fly    72 DLKGIYILTFKRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCP---LKMNK 133

  Fly   133 NFY-----LRSEKLPTPIPTGEYL 151
            .:|     :.|:.:|:.:|...::
  Fly   134 RYYAKGFTVNSKFIPSYMPETNFI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 18/75 (24%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 16/63 (25%)

Return to query results.
Submit another query.