DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG33643

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:138 Identity:35/138 - (25%)
Similarity:60/138 - (43%) Gaps:31/138 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VCETYNKSWVEFGLCRLRAVSRNKVCLNVDA-NLLHPVHDVIVKARLLKRANGYKPWLYSVSFDG 94
            |.::.|:|:|...:...|.|.:      .|| |:|..|           |.||.:..||....|.
  Fly    47 VDQSSNRSYVNCHMLLNREVGK------FDARNVLDFV-----------RPNGQEMKLYEGRLDA 94

  Fly    95 CQFIRR-RNNALIRIVWELFKEYSTINHTCP------YVGLQQVKNFYLRSEKLPTPIPTGEYLL 152
            |..:.. :.|.|:.|..:.||.:|.:.  ||      |.    :||.|:..:..|:.:|:|.:..
  Fly    95 CLLLGSIQKNRLVNIYSKTFKRFSNVE--CPLKANFNYT----MKNLYMDEQDFPSFVPSGTFRS 153

  Fly   153 MIDWVFNK 160
            :|::..|:
  Fly   154 LIEFYLNQ 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 21/85 (25%)
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 22/78 (28%)

Return to query results.
Submit another query.