DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG33752

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:155 Identity:46/155 - (29%)
Similarity:75/155 - (48%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWL 87
            |.:.||..||..:||:.||.:|:|..:.|..:..:|....|. |:..:.|...:.|:.:||.|:|
  Fly    23 ITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFL 87

  Fly    88 YSVSFDGCQFIRRRNNA-LIRIVWELFKEYSTINHTCPYVGLQQ-----VKNFYLRSEKL-PTPI 145
            ::|:.|.|.:::..|.. :....:...|.||..||:|||...:.     ||:|.|..... ..|:
  Fly    88 FNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTDTMFAKIPL 152

  Fly   146 PTGEYLLMIDWVFNKKPQAATNVYF 170
            |||.|:..|....:...:...|.||
  Fly   153 PTGNYMFSIKLATDDVWRVVLNTYF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 28/95 (29%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 27/86 (31%)

Return to query results.
Submit another query.