DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG33137

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:138 Identity:40/138 - (28%)
Similarity:71/138 - (51%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VIFKMTNAVCETY-----NKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKR--A 80
            :::|:.|..|.|.     |.|      |.:||::.||....:|..||.|::::.::.::||:  :
  Fly    12 IVYKLKNIECSTVPGFSANAS------CHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYS 70

  Fly    81 NGYKPWLYSVSFDGCQFIRRRNNALI---RIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLP 142
            |.::|:|..|..:.|..:.||  :.|   .|:.::.:.:|..||:|||.|....:..||....||
  Fly    71 NKFQPFLVDVVINMCDALSRR--SFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLP 133

  Fly   143 TPIPTGEY 150
            ...|.|.|
  Fly   134 NVFPLGFY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 22/71 (31%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 22/71 (31%)

Return to query results.
Submit another query.