DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG33476

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:134 Identity:34/134 - (25%)
Similarity:54/134 - (40%) Gaps:38/134 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RLRAVSR---NKVCLNVDANLLHPVHDV-----IVKARLLKRANGY-----------KPWLYSV- 90
            |.|..|:   ..:..:.|.|.:...|..     |...|::|.|..:           |..:|.| 
  Fly    12 RFRGGSKFIMESLATSCDHNFVEYFHKAPDMVDIYTFRVVKLAKAFTIDFAVRVVKTKRVMYKVD 76

  Fly    91 SFDGCQFIRRRNNALIRIVWELFKEYSTIN---HTCPYVGLQQVKN--FYLRSE----KLPTPIP 146
            :||||||:  .|..:.|:...::|.. .:|   .:||      :|.  :|:|:|    .||...|
  Fly    77 NFDGCQFL--MNPLMNRVFGTVYKRL-VVNGSFFSCP------IKPGVYYIRNEGSVAMLPVFQP 132

  Fly   147 TGEY 150
            .|.|
  Fly   133 PGRY 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 24/89 (27%)
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 24/89 (27%)

Return to query results.
Submit another query.