DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG30050

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:85 Identity:21/85 - (24%)
Similarity:40/85 - (47%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LYSVSFDGCQFIRRRNNALI--RIVWELFKEYSTINHTCPY-VGLQQVKNFYLRSEKLPTPIPTG 148
            ::.::||.|:.:|.|...::  .:|..|.|..:.....||: .|..:.:|..:..  ||..:...
  Fly    91 IFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISVTD--LPPMLTES 153

  Fly   149 EYLLMIDWVFNKKPQAATNV 168
            |:.:.:|: |..|...|.||
  Fly   154 EFFVNLDF-FIPKVAIAMNV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 21/85 (25%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 21/85 (25%)

Return to query results.
Submit another query.