DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wat and LYS2

DIOPT Version :9

Sequence 1:NP_651652.2 Gene:wat / 43420 FlyBaseID:FBgn0039620 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_009673.1 Gene:LYS2 / 852412 SGDID:S000000319 Length:1392 Species:Saccharomyces cerevisiae


Alignment Length:502 Identity:106/502 - (21%)
Similarity:193/502 - (38%) Gaps:141/502 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EDHCQLISDVKDESPMQMFYKDK---------GVFLTGGTGFFGKIIIEKLLRVTEVG---QIYL 69
            ||..:|:..:....|.:.::.:.         .||:||.|||.|..|:..||..:...   :::.
Yeast   940 EDAKKLVETLPSSYPSREYFVEPNSAEGKTTINVFVTGVTGFLGSYILADLLGRSPKNYSFKVFA 1004

  Fly    70 LIRTKKGKDAFARIEDLFNDPVFAKMKQVNPKYRCQITIISGDCSLPGLGISADERETIMENVNI 134
            .:|.|..:.||||::     .........|.|:...|.::.||.|....|:|.::...:...|:|
Yeast  1005 HVRAKDEEAAFARLQ-----KAGITYGTWNEKFASNIKVVLGDLSKSQFGLSDEKWMDLANTVDI 1064

  Fly   135 VLHSAATVRFDEKLKMAIAINVHGTKEIIKLAKEIVNLKALVHVSTAFAHCNMRHIQERFYSGTM 199
            ::|:.|.|.:..........||..|..::.|| .:...|....||:               :.|:
Yeast  1065 IIHNGALVHWVYPYAKLRDPNVISTINVMSLA-AVGKPKFFDFVSS---------------TSTL 1113

  Fly   200 SGENAFKLSECLDEHTLNTLTPTIIK---------GYPNTYTFTKVLAENVVQQSAQ-NLPVTIF 254
            ..|..|.||:.|    ::...|.|::         |....|..:|..||.:::::.: .|...|.
Yeast  1114 DTEYYFNLSDKL----VSEGKPGILESDDLMNSASGLTGGYGQSKWAAEYIIRRAGERGLRGCIV 1174

  Fly   255 RPGIVITTYREPVTGWIDNMYGPCGVIVGIGSG-----VLRVFTG--------DMDNKAHIVPVD 306
            |||.        |||...|           ||.     :||...|        |::|..::||||
Yeast  1175 RPGY--------VTGASAN-----------GSSNTDDFLLRFLKGSVQLGKIPDIENSVNMVPVD 1220

  Fly   307 MCVNALLASAWDIARNKYETPPIYNYVPDAE----NMVTWRRYMEDGFEYGCDIPMRKSIWYPRF 367
            .....::|::.:        ||..|.:..|:    ..:.::.|:....:||.|:.:..   |.: 
Yeast  1221 HVARVVVATSLN--------PPKENELAVAQVTGHPRILFKDYLYTLHDYGYDVEIES---YSK- 1273

  Fly   368 TIVPHMWQYHILCFLYHTLPALVMDAIMVIIGKKPRMMKIYRKIHKLSNVLKYFSSNEFRFDNDN 432
                  |:        .:|.|.|:|        :.....:|..:|.:.               ||
Yeast  1274 ------WK--------KSLEASVID--------RNEENALYPLLHMVL---------------DN 1301

  Fly   433 VRKLTE--KLDDRD-----KRLFAFDMRDLDWTNLFRVSLYGLRLYV 472
            :.:.|:  :||||:     |:..|:  ..:||:|...|:...:.:|:
Yeast  1302 LPESTKAPELDDRNAVASLKKDTAW--TGVDWSNGIGVTPEEVGIYI 1346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
watNP_651652.2 PLN02996 35..474 CDD:215538 102/484 (21%)
FAR-N_SDR_e 39..342 CDD:187547 76/341 (22%)
FAR_C 382..472 CDD:176924 19/96 (20%)
LYS2NP_009673.1 alpha_am_amid 7..1379 CDD:274582 106/502 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I2873
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.712175 Normalized mean entropy S3219
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.