DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wat and FAR1

DIOPT Version :9

Sequence 1:NP_651652.2 Gene:wat / 43420 FlyBaseID:FBgn0039620 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_011518702.1 Gene:FAR1 / 84188 HGNCID:26222 Length:518 Species:Homo sapiens


Alignment Length:485 Identity:169/485 - (34%)
Similarity:274/485 - (56%) Gaps:15/485 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FYKDKGVFLTGGTGFFGKIIIEKLLR-VTEVGQIYLLIRTKKGKDAFARIEDLFNDPVFAKMKQV 98
            :|:.|.|.|||.|||.||:::||||| ..:|..:|:|:|.|.|:....|:|::.:..:|.:::..
Human     7 YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDE 71

  Fly    99 NPKYRCQITIISGDCSLPGLGISADERETIMENVNIVLHSAATVRFDEKLKMAIAINVHGTKEII 163
            ||.:|.:|..|:.:.:.|.|.:|.:::|.|:::.||:.|.||||||:|.|:.|:.:||..|:::|
Human    72 NPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNENLRDAVQLNVIATRQLI 136

  Fly   164 KLAKEIVNLKALVHVSTAFAHCNMRHIQERFYSGTMSGENAFKLSECLDEHTLNTLTPTIIKGYP 228
            .||:::.||:..:|||||:|:||.:||.|..|...:..:......|.:|:..:|.:||.:|...|
Human   137 LLAQQMKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDSLEWMDDGLVNDITPKLIGDRP 201

  Fly   229 NTYTFTKVLAENVVQQSAQNLPVTIFRPGIVITTYREPVTGWIDNMYGPCGVIVGIGSGVLRVFT 293
            |||.:||.|||.||||....|.|.|.||.||..:::||..|||||..||.|:.:..|.|:||...
Human   202 NTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPFPGWIDNFNGPSGLFIAAGKGILRTIR 266

  Fly   294 GDMDNKAHIVPVDMCVNALLASAWDIARNKYETP---PIYNYVPDAENMVTW---RRYMEDGFEY 352
            ...:..|.:||||:.||..||:||....|:|..|   .:||....:.|...|   ..::...|:.
Human   267 ASNNALADLVPVDVVVNMSLAAAWYSGVNRYMRPRNIMVYNCTTGSTNPFHWGEVEYHVISTFKR 331

  Fly   353 GCDIPMRKSIWYPRFTIVPHMWQYHILCFLYHTLPALVMDAIMVIIGKKPRMMKIYRKIHKLSNV 417
            .   |:.::...|...:..:...||....:.|..||.:.|..:.:.|:.|||||...::||....
Human   332 N---PLEQAFRRPNVNLTSNHLLYHYWIAVSHKAPAFLYDIYLRMTGRSPRMMKTITRLHKAMVF 393

  Fly   418 LKYFSSNEFRFDNDNVRKLTEKLDDRDKRLFAFDMRDLDWTNLFRVSLYGLRLYVVKDDPSNIPE 482
            |:||:||.:.::.:||..|..:|:..||:.|..|:|.|.|.........|.:.||:.::.|.:|.
Human   394 LEYFTSNSWVWNTENVNMLMNQLNPEDKKTFNIDVRQLHWAEYIENYCLGTKKYVLNEEMSGLPA 458

  Fly   483 SIKRYERLKVLHY--TTLAVFYALAAWALY 510
            :.|...:|:.:.|  .|:.|   :..|.::
Human   459 ARKHLNKLRNIRYGFNTILV---ILIWRIF 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
watNP_651652.2 PLN02996 35..474 CDD:215538 161/445 (36%)
FAR-N_SDR_e 39..342 CDD:187547 123/306 (40%)
FAR_C 382..472 CDD:176924 29/89 (33%)
FAR1XP_011518702.1 PLN02996 2..449 CDD:215538 160/444 (36%)
FAR-N_SDR_e 11..333 CDD:187547 125/324 (39%)
Sterile 360..450 CDD:281068 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3320
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41718
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D221518at33208
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100550
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X145
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.