DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MOS and slpr

DIOPT Version :9

Sequence 1:NP_005363.1 Gene:MOS / 4342 HGNCID:7199 Length:346 Species:Homo sapiens
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:342 Identity:78/342 - (22%)
Similarity:148/342 - (43%) Gaps:86/342 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    27 PSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIK---- 87
            |.:|.....:|...|.           .|::.::.:.:.:|:|||..|::..|.|..||||    
  Fly   107 PLQLNVSSAIGDIQPH-----------EIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQ 160

Human    88 ----QVNKCTKNRLASRRSFWAELNVARLRHDNI--VRVVAASTRTPAGSNSLGTIIMEFGGNVT 146
                .:.:...|.|...:.|||      |:|:||  :|.|..:|:.        .::||:....:
  Fly   161 TGEDDMQRMRDNVLQEAKLFWA------LKHENIAALRGVCLNTKL--------CLVMEYARGGS 211

Human   147 LHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQ---SIVHLDLKPANIL 208
            |::::                  .|::.....:.:::.:..|:.:||::   ||:|.|||.:|:|
  Fly   212 LNRIL------------------AGKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVL 258

Human   209 ISE--------QDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSF 265
            |.|        |...||:|||.:.::     :.|......|||....||::.....:..:|::|:
  Fly   259 IYEAIEGNHLQQKTLKITDFGLAREM-----YNTQRMSAAGTYAWMPPEVISVSTYSKFSDVWSY 318

Human   266 AITLWQMTTKQAPYSG-ERQHILYAVVAYDLRPSLSAAVFEDSLP-----GQRLGDVIQRCWRPS 324
            .:.||::.|.:.||.| :...:.|.|....|           :||     .:..|.:::.||:..
  Fly   319 GVLLWELITGETPYKGFDPLSVAYGVAVNTL-----------TLPIPKTCPETWGALMKSCWQTD 372

Human   325 AAQRPSARLLLVDLTSL 341
            ..:||..:.:|..|.|:
  Fly   373 PHKRPGFKEILKQLESI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MOSNP_005363.1 STKc_Mos 56..338 CDD:270881 71/308 (23%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 71/304 (23%)
STKc_MLK 134..389 CDD:270963 72/302 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.