DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and PAPLN

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:428 Identity:80/428 - (18%)
Similarity:132/428 - (30%) Gaps:171/428 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SGSTQNQHHESSSQLD---PDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLR-----ASD 77
            :||.....|.||.::.   .:|..      |....|:...|:||.....:::..|.:     :||
Human   895 AGSPAPPFHSSSYRISLAGVEPSL------VQAALGQLVRLSCSDDTAPESQAAWQKDGQPISSD 953

  Fly    78 QTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSP----MKKQVGCI--D 136
            :..|...|.::.|                   .|:..|.|.|.|. :|.|    .|.|:..|  |
Human   954 RHRLQFDGSLIIH-------------------PLQAEDAGTYSCG-STRPGRDSQKIQLRIIGGD 998

  Fly   137 VQV-----------PPDIINEESSADLA----------------------------VQEGEDATL 162
            :.|           |.|...:...|..|                            ...|:...:
Human   999 MAVLSEAELSRFPQPRDPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASPGQRIRM 1063

  Fly   163 TCKATGNPQPRVTWRREDGEMI-----LIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIA 222
            ||:|.|.|.|.:.|:| ||:.:     .::..||..:.:|...:|             |.|.|:|
Human  1064 TCRAEGFPPPAIEWQR-DGQPVSSPRHQLQPDGSLVISRVAVEDG-------------GFYTCVA 1114

  Fly   223 SN--------------------DVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEA 267
            .|                    .:||.|:                     .|.|...:|.|.|..
Human  1115 FNGQDRDQRWVQLRVLGELTISGLPPTVT---------------------VPEGDTARLLCVVAG 1158

  Fly   268 SPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPS 332
            .                  ||:.....:|.|   :..||  :.:.:..||     .|::.:....
Human  1159 E------------------SVNIRWSRNGLP---VQADG--HRVHQSPDG-----TLLIYNLRAR 1195

  Fly   333 DVGTYHCVSTNSLGRAEGTLRLYEIK-LHPGASASNDD 369
            |.|:|.|   ::...::...|..|:| :.|..:|...|
Human  1196 DEGSYTC---SAYQGSQAVSRSTEVKVVSPAPTAQPRD 1230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 22/102 (22%)
Ig 47..129 CDD:299845 18/90 (20%)
Ig 140..238 CDD:299845 27/150 (18%)
IG_like 247..355 CDD:214653 19/107 (18%)
Ig 256..351 CDD:299845 17/94 (18%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 3/9 (33%)
Ig 914..>978 CDD:325142 16/88 (18%)
I-set 1049..1119 CDD:254352 20/83 (24%)
IG 1139..1219 CDD:214652 23/131 (18%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.