DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Chl1

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_038964701.1 Gene:Chl1 / 89828 RGDID:620122 Length:1224 Species:Rattus norvegicus


Alignment Length:351 Identity:76/351 - (21%)
Similarity:121/351 - (34%) Gaps:76/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SGSTQNQHHESS-SQLDP----DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTV 80
            |.||:..:..:| .|..|    .|..||..::.|...|...:|.|....|...::.|.:...:..
  Rat   233 SSSTEISNQANSIKQRKPKLLLPPAQIGSASSKTVLKGDTLLLECFAEGLPTPQIEWSKLGSELP 297

  Fly    81 LALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGC-IDVQVPPDII 144
               :||...          ::|...|||..:...|||.|.|..|....|..... :.|:.||...
  Rat   298 ---KGRATI----------EIHEKTLKIENVSYQDRGNYRCTANNLLGKASHDFHVIVEEPPRWK 349

  Fly   145 NEESSADLAVQEGEDATLTCKATGNPQPRVTWRRE---------DGEMILIRKPGSRELMKVESY 200
            .:..||  ....|.:..|.|:|.|.|||.:.||..         .|:::..|:            
  Rat   350 KKPQSA--VYSTGSNGILLCEAEGEPQPTIKWRVNGLPIENHPFPGDVMFPRE------------ 400

  Fly   201 NGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLS-VQFAPMVRAPS-QLLGTPLGSDVQLEC 263
                :....|:......|.|.||| :...:....::. |...|:::..: :...|.:|....|.|
  Rat   401 ----ISFTNLQPNHTAVYQCEASN-IHGTILANANIDVVDVVPLIQTKNEENYETVVGYSAFLHC 460

  Fly   264 QVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRS 328
            :..|||.....|.....|..                    |:|.:|...|..       .|.:..
  Rat   461 EYFASPKATVVWEVADETHP--------------------LEGGRYHTHENG-------TLEIER 498

  Fly   329 FSPSDVGTYHCVSTNSLGRAEGTLRL 354
            .:..|.|:|.|...|::|:|..|..|
  Rat   499 TTEEDAGSYSCWVDNTMGKAVITANL 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 18/81 (22%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 21/106 (20%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 0/3 (0%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 23/109 (21%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
Chl1XP_038964701.1 Ig 34..125 CDD:472250
Ig strand B 52..56 CDD:409353
Ig strand C 65..69 CDD:409353
Ig strand E 89..93 CDD:409353
Ig strand F 105..110 CDD:409353
Ig strand G 119..122 CDD:409353
IgI_2_L1-CAM_like 134..224 CDD:409432
Ig strand A 134..137 CDD:409432
Ig strand A' 139..143 CDD:409432
Ig strand B 146..154 CDD:409432
Ig strand C 161..167 CDD:409432
Ig strand C' 170..173 CDD:409432
Ig strand D 179..183 CDD:409432
Ig strand E 185..189 CDD:409432
Ig strand F 200..208 CDD:409432
Ig strand G 211..224 CDD:409432
Ig 261..343 CDD:472250 19/94 (20%)
Ig strand B 273..277 CDD:409353 1/3 (33%)
Ig strand C 286..290 CDD:409353 0/3 (0%)
Ig strand E 308..312 CDD:409353 1/3 (33%)
Ig strand F 322..327 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig4_L1-NrCAM_like 347..434 CDD:409367 20/105 (19%)
Ig strand B 363..367 CDD:409367 1/3 (33%)
Ig strand C 376..380 CDD:409367 0/3 (0%)
Ig strand E 399..403 CDD:409367 1/19 (5%)
Ig strand F 413..418 CDD:409367 2/4 (50%)
Ig strand G 426..429 CDD:409367 0/2 (0%)
Ig 447..524 CDD:472250 22/103 (21%)
Ig strand B 456..460 CDD:409353 1/3 (33%)
Ig strand C 469..473 CDD:409353 0/3 (0%)
Ig strand E 492..496 CDD:409353 1/10 (10%)
Ig strand F 506..511 CDD:409353 2/4 (50%)
Ig strand G 519..522 CDD:409353 0/2 (0%)
Ig 528..627 CDD:472250
Ig strand B 547..551 CDD:409353
Ig strand C 564..568 CDD:409353
Ig strand E 589..593 CDD:409353
Ig strand F 603..608 CDD:409353
Ig strand G 616..619 CDD:409353
FN3 <626..>867 CDD:442628
FN3 627..716 CDD:238020
FN3 832..926 CDD:238020
FN3 931..1026 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.