DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr21

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:99/272 - (36%) Gaps:52/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKLLQSTLFV-ILIMATKCGSGSTQNQHHESS-----------------SQLDPDPEF-IGFIN 46
            |:..|...:|: |||:...|      .||...:                 ..||..|.| .....
  Fly     1 MKVFLTFRIFLCILILKETC------PQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATK 59

  Fly    47 NVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARI-SVMHQDMHTWKLKISK 110
            |||...|....|.|.::|||...|.|:|..|..:|.:.....|.:.|. |:.::....|.|:|..
  Fly    60 NVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKF 124

  Fly   111 LRESDRGCYMCQINTSPMKKQVGCIDV-QVPPDIINEESSADLAVQEGEDATLTCKATGNPQP-- 172
            .:..|.|.|.||::|:|   .||...| .|...|.:.....::.:..|....|||.....|.|  
  Fly   125 PQLRDSGIYECQVSTTP---PVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPI 186

  Fly   173 RVTWRREDGEMILIRKPGSRELMKVESYNG----SSLRLLRLERRQMGAYLCIASN--------- 224
            .|.|...:.|   |.....|..:.|.:..|    |.|.:.|......|.|.|:.||         
  Fly   187 SVQWNHNNQE---INYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVNVH 248

  Fly   225 ----DVPPAVSK 232
                |.|.||.|
  Fly   249 ILKGDHPAAVQK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 30/93 (32%)
Ig 47..129 CDD:299845 27/82 (33%)
Ig 140..238 CDD:299845 27/112 (24%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
dpr21NP_001163838.2 Ig 71..149 CDD:299845 25/80 (31%)
IG_like 71..140 CDD:214653 21/68 (31%)
IG_like 162..249 CDD:214653 21/89 (24%)
IGc2 169..242 CDD:197706 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.