DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr21

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:99/272 - (36%) Gaps:52/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKLLQSTLFV-ILIMATKCGSGSTQNQHHESS-----------------SQLDPDPEF-IGFIN 46
            |:..|...:|: |||:...|      .||...:                 ..||..|.| .....
  Fly     1 MKVFLTFRIFLCILILKETC------PQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATK 59

  Fly    47 NVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARI-SVMHQDMHTWKLKISK 110
            |||...|....|.|.::|||...|.|:|..|..:|.:.....|.:.|. |:.::....|.|:|..
  Fly    60 NVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKF 124

  Fly   111 LRESDRGCYMCQINTSPMKKQVGCIDV-QVPPDIINEESSADLAVQEGEDATLTCKATGNPQP-- 172
            .:..|.|.|.||::|:|   .||...| .|...|.:.....::.:..|....|||.....|.|  
  Fly   125 PQLRDSGIYECQVSTTP---PVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPI 186

  Fly   173 RVTWRREDGEMILIRKPGSRELMKVESYNG----SSLRLLRLERRQMGAYLCIASN--------- 224
            .|.|...:.|   |.....|..:.|.:..|    |.|.:.|......|.|.|:.||         
  Fly   187 SVQWNHNNQE---INYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVNVH 248

  Fly   225 ----DVPPAVSK 232
                |.|.||.|
  Fly   249 ILKGDHPAAVQK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 27/82 (33%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 27/111 (24%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653
Ig strand B 259..263 CDD:409358
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
dpr21NP_001163838.2 Ig 71..149 CDD:472250 25/80 (31%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 21/82 (26%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 2/3 (67%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.