DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and KIRREL2

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:412 Identity:100/412 - (24%)
Similarity:148/412 - (35%) Gaps:117/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PDPEFIGFINNVTYPAGREAILACSVRNLGK--NKVGWLRASDQTVLALQGRVVTHNARISVMHQ 99
            |.|.|:....::....|.||.|.|:   ||.  ..|.|.::.    |||.|:            :
Human    22 PSPHFLQQPEDLVVLLGEEARLPCA---LGAYWGLVQWTKSG----LALGGQ------------R 67

  Fly   100 DMHTWK--------------LKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSA 150
            |:..|.              |.|..:...|...|.||...:.::.:...:.|.|||:........
Human    68 DLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGP 132

  Fly   151 DLAVQEGEDATLTCKATGN--PQPRVTWRRE----DG---EMILIRK--PGSRELMKVESYNGSS 204
            .:::..|..|.|||::.|:  |.|.:.|.|:    ||   ...|:::  |||.|         |:
Human   133 SVSLVAGVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVE---------ST 188

  Fly   205 LRLLRLERRQMGAYLCIA-SNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEAS 268
            |.|..........::|.| |..:|......::||:|:.|.|...:.......|..|...||..|.
Human   189 LTLTPFSHDDGATFVCRARSQALPTGRDTAITLSLQYPPEVTLSASPHTVQEGEKVIFLCQATAQ 253

  Fly   269 PSPVSY-WLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVV--RSFS 330
            |....| |.||                 |||    :|            |.||..|.||  .||.
Human   254 PPVTGYRWAKG-----------------GSP----VL------------GARGPRLEVVADASFL 285

  Fly   331 PSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASASNDDHLNYIGGLEEAARN-AGRSN---RTT 391
            ...|.   |..:|::|.|..:..| ::...|...|..:.....:|  |:|:.: |.|.|   |.|
Human   286 TEPVS---CEVSNAVGSANRSTAL-DVLFGPILQAKPEPVSVDVG--EDASFSCAWRGNPLPRVT 344

  Fly   392 WQPLLAMLMLLWMRLSLRTGGA 413
            |               .|.|||
Human   345 W---------------TRRGGA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 22/107 (21%)
Ig 47..129 CDD:299845 21/97 (22%)
Ig 140..238 CDD:299845 27/109 (25%)
IG_like 247..355 CDD:214653 27/110 (25%)
Ig 256..351 CDD:299845 27/97 (28%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 21/107 (20%)
IGc2 38..106 CDD:197706 21/86 (24%)
I-set 126..224 CDD:254352 26/106 (25%)
Ig2_KIRREL3-like 141..223 CDD:143236 24/90 (27%)
Cell attachment site. /evidence=ECO:0000255 149..151 0/1 (0%)
Ig 231..306 CDD:299845 27/110 (25%)
IG_like 234..308 CDD:214653 28/110 (25%)
Ig 312..395 CDD:299845 15/57 (26%)
I-set 317..395 CDD:254352 13/52 (25%)
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.