DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and si:ch211-57n23.4

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_009292645.2 Gene:si:ch211-57n23.4 / 799595 ZFINID:ZDB-GENE-140106-153 Length:722 Species:Danio rerio


Alignment Length:358 Identity:81/358 - (22%)
Similarity:133/358 - (37%) Gaps:70/358 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ATKCGSGSTQNQHH-------ESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWL 73
            ||..|......|:|       ::..||...|:|.....:::...|..|...|.|..:.:..:.| 
Zfish    92 ATDAGEYYCAAQNHYGMLVSRKARVQLASLPKFHTHPESMSVDDGGVARFQCQVNGIPEASITW- 155

  Fly    74 RASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQ----INTSPMKKQVGC 134
             ..|..||.      |.:.|.:::...:    |:|:.::::|.|.|.|.    .||....:....
Zfish   156 -EKDHVVLG------TSDDRYTLLPMGI----LQITGVKKADAGIYRCVASNIANTRYSHEAHLN 209

  Fly   135 IDVQVP-----PDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSREL 194
            :...||     |.|::...:..:.|.  :.|.|.|.|||||:|.|:|.|.||..|.:.       
Zfish   210 VTGGVPRTYKEPVILSGPQNLTITVH--QTAILECIATGNPRPIVSWSRLDGRSIGVE------- 265

  Fly   195 MKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLS---VQFAPMVRAPSQLLGTPLG 256
             .::.....:|.:..:..:..|.|:|.|:.  |....:|.:|.   ||..|......|.:..|.|
Zfish   266 -GIQVLGTGNLMISDVSLQHSGVYVCAANR--PGTRMRRTALGRLVVQAPPEFIQWPQSVSKPAG 327

  Fly   257 SDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGV 321
            ......|..:..|.|...|||     ||                ::|..|....:|....     
Zfish   328 GSAVFTCVAQGVPEPHIIWLK-----NG----------------KILTPGDNVKLTNNNS----- 366

  Fly   322 MLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRL 354
             .|.|...:..|...|.|::.|:.|..:.:.||
Zfish   367 -TLAVTRITSEDEAIYQCIAENTAGTNQASARL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 18/95 (19%)
Ig 47..129 CDD:299845 18/85 (21%)
Ig 140..238 CDD:299845 27/105 (26%)
IG_like 247..355 CDD:214653 23/108 (21%)
Ig 256..351 CDD:299845 19/94 (20%)
si:ch211-57n23.4XP_009292645.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.