DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and nectin4b

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_001334985.6 Gene:nectin4b / 794920 ZFINID:ZDB-GENE-070912-114 Length:570 Species:Danio rerio


Alignment Length:404 Identity:86/404 - (21%)
Similarity:153/404 - (37%) Gaps:113/404 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKLLQSTLFVILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILAC---SV 62
            |.|||....|::..:...|.                   ||:....::...:|.||.|.|   :.
Zfish     1 MSKLLNIGAFLLTFIVCVCS-------------------EFMDSPMSLRSFSGSEARLKCVFVAP 46

  Fly    63 RNLGKNKVGWLR--ASDQTVLALQGRVVTHNARISVMHQDMHTWK---------LKISKLRESDR 116
            |::...:|.|.|  .:.:|...:.|. .|...::|....|...::         |.|.....:|.
Zfish    47 RDVTVVQVTWSRHTPAGKTQQIITGH-YTEGPKVSPEFADGFRFESPDPLTDSTLLIENTVRADE 110

  Fly   117 GCYMCQINTSP---MKKQVGCIDVQVPPDIINEESSADLAVQEGED--ATLTCKATGNPQPRVTW 176
            |.|.|.|.|.|   .::::. :.|.:.|    ..|...:.::||:.  ...:|:|..:|..|::|
Zfish   111 GVYTCSIATFPSGNFQRRIS-LSVWMYP----ISSVEHVVLKEGQSYGIAASCRAVAHPPARLSW 170

  Fly   177 ----------RREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDV---PP 228
                      |..||.::..:    ..|....|.||..|.             |:..:.|   |.
Zfish   171 DTDVSGQSQNRSGDGGVVTTQ----FSLYPSRSMNGQKLD-------------CLVWHPVYEEPH 218

  Fly   229 AVSKRVSLSVQFAP---MVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVST 290
            .::.:  |.|||.|   .|.:.|..:|:. ||:::  |.|:.:|.|              .:||.
Zfish   219 RLANK--LVVQFPPDAEAVGSGSWQIGSS-GSEIR--CLVKGNPLP--------------QNVSW 264

  Fly   291 ASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLG--RAEGTLR 353
            :..:...|.          |:..::|     .|:..|....:|.|.|.|.:.|:||  :||.||:
Zfish   265 SRSDGVLPS----------GVLVQKD-----RLVFSRPLQQTDEGVYVCRTHNTLGVAKAEFTLQ 314

  Fly   354 LYEIKLHPGASASN 367
            :..::.....|:|:
Zfish   315 IDAVRSEFSISSSH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 23/98 (23%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 1/12 (8%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 21/111 (19%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 2/13 (15%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 1/4 (25%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 26/109 (24%)
Ig strand B 259..263 CDD:409358 0/3 (0%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
nectin4bXP_001334985.6 Ig 34..134 CDD:472250 23/101 (23%)
Ig strand B 37..41 CDD:409471 2/3 (67%)
Ig strand C 53..57 CDD:409471 1/3 (33%)
Ig strand E 98..102 CDD:409471 1/3 (33%)
Ig strand F 112..117 CDD:409471 2/4 (50%)
Ig strand G 126..129 CDD:409471 0/2 (0%)
Ig 146..226 CDD:472250 19/98 (19%)
Ig strand B 154..158 CDD:409501 0/3 (0%)
Ig strand C 167..171 CDD:409501 1/3 (33%)
Ig strand E 190..194 CDD:409501 0/7 (0%)
Ig strand F 204..209 CDD:409501 2/17 (12%)
Ig strand G 219..222 CDD:409501 0/2 (0%)
Ig 248..315 CDD:472250 22/97 (23%)
Ig strand B 248..251 CDD:409390 0/4 (0%)
Ig strand C 261..265 CDD:409390 2/3 (67%)
Ig strand E 281..285 CDD:409390 1/3 (33%)
Ig strand F 295..300 CDD:409390 2/4 (50%)
Ig strand G 308..311 CDD:409390 1/2 (50%)

Return to query results.
Submit another query.