DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and zgc:152904

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001070212.1 Gene:zgc:152904 / 767777 ZFINID:ZDB-GENE-060929-856 Length:809 Species:Danio rerio


Alignment Length:369 Identity:88/369 - (23%)
Similarity:142/369 - (38%) Gaps:81/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KCGSGSTQNQHHESSSQLD----------PDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGW 72
            :|.:...:.|..|::..|:          ..|:        .:..|.:|.:.|.|.:.....|.|
Zfish    61 RCQAADAKGQSQEATVVLEIYQKLTFREVKTPQ--------EFRQGDDAEVVCDVISSPVPAVSW 117

  Fly    73 LRASDQTVLALQGRVVTH--NARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCI 135
            .         .:.|.:|.  |:|..|    :.|..|:|.|:.::|.|.|.|:......    |.|
Zfish   118 F---------YKNREITSEPNSRFQV----LPTNNLQILKVGKADEGAYRCEARVEAR----GEI 165

  Fly   136 D-------VQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRE 193
            |       |.|||.:...:.|.:......|..|.||..:|:|.|:|||..: |..|     ...|
Zfish   166 DFRDIVVQVNVPPVLSVPQQSFNATADYQESVTFTCVTSGSPDPQVTWYWK-GHAI-----EHSE 224

  Fly   194 LMKVESYNG--SSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPL- 255
            ...:.:.||  |:|.:..:::...|.|:|.|||....:.| ::.|.|...|.:   :||..... 
Zfish   225 QYVLNTMNGGKSTLTVKNIKQTDGGPYMCRASNKAGSSES-QLFLKVFVQPHI---TQLRNVTAV 285

  Fly   256 -GSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKY--GITERRDG 317
             ||...:.|..|..|.|...|   .|.|:|.:                ..||.|.  |..|.| |
Zfish   286 EGSAAMISCTAEGEPLPEISW---RRASDGHS----------------FTDGEKSKDGRVEVR-G 330

  Fly   318 YRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHP 361
            ..|..:|.:.....||.|.:.|.:.:.:|..:.::.| :|:..|
Zfish   331 RHGKSMLTISGVQLSDWGRFDCEALSRIGGHQKSMFL-DIEYAP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 23/100 (23%)
Ig 47..129 CDD:299845 19/83 (23%)
Ig 140..238 CDD:299845 28/99 (28%)
IG_like 247..355 CDD:214653 26/111 (23%)
Ig 256..351 CDD:299845 24/96 (25%)
zgc:152904NP_001070212.1 Ig 1..81 CDD:299845 4/19 (21%)
IG_like 2..80 CDD:214653 4/18 (22%)
IGc2 97..158 CDD:197706 19/73 (26%)
Ig 177..273 CDD:299845 29/102 (28%)
I-set 184..270 CDD:254352 26/92 (28%)
Ig 272..369 CDD:299845 28/120 (23%)
I-set 274..367 CDD:254352 27/115 (23%)
IG_like 385..462 CDD:214653
IGc2 386..454 CDD:197706
FN3 468..561 CDD:238020
fn3 <591..650 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.