DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Negr1

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_038958934.1 Gene:Negr1 / 59318 RGDID:708416 Length:362 Species:Rattus norvegicus


Alignment Length:324 Identity:90/324 - (27%)
Similarity:140/324 - (43%) Gaps:49/324 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 INNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKIS 109
            ::|:....|..|:|.|.:.: |.:|..||..|  :::...|...:.:.|:|:...:...:.|:|.
  Rat    39 VDNMLVRKGDTAVLRCYLED-GASKGAWLNRS--SIIFAGGDKWSVDPRVSISTLNKRDYSLQIQ 100

  Fly   110 KLRESDRGCYMCQINT--SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQP 172
            .:..:|.|.|.|.:.|  :|...||. :.|||||.|.  :.|.|:.:.||.:.||||.|||.|:|
  Rat   101 NVDVTDDGPYTCSVQTQHTPRTMQVH-LTVQVPPKIY--DISNDMTINEGTNVTLTCLATGKPEP 162

  Fly   173 RVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLS 237
            .::||.        ..|.::..     .||..|.:..:.|.|.|.|.|.|.|||.....|:|.:.
  Rat   163 AISWRH--------ISPSAKPF-----ENGQYLDIYGITRDQAGEYECSAENDVSFPDVKKVRVV 214

  Fly   238 VQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKG-ARTSNGFASVSTASLESGSPGPE 301
            |.|||.::.......|| |....:.|:....|.|...|.|| .|..||...:...:..:.|    
  Rat   215 VNFAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYKGEKRLFNGQQGIIIQNFSTRS---- 274

  Fly   302 MLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASA 365
                                 :|.|.:.:....|.|.||:.|.||....:|.|.:| :.|..|:
  Rat   275 ---------------------ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNQI-IEPTTSS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 24/93 (26%)
Ig 47..129 CDD:299845 21/83 (25%)
Ig 140..238 CDD:299845 33/97 (34%)
IG_like 247..355 CDD:214653 23/108 (21%)
Ig 256..351 CDD:299845 20/95 (21%)
Negr1XP_038958934.1 FR1 38..55 CDD:409353 4/15 (27%)
Ig strand A' 40..46 CDD:409353 1/5 (20%)
IG_like 41..129 CDD:214653 23/91 (25%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 3/6 (50%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 2/11 (18%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 8/34 (24%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 2/7 (29%)
Ig strand A' 139..144 CDD:409353 2/4 (50%)
IGc2 146..204 CDD:197706 25/70 (36%)
Ig strand B 150..157 CDD:409353 4/6 (67%)
Ig strand C 163..168 CDD:409353 1/4 (25%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 1/5 (20%)
Ig strand F 193..200 CDD:409353 3/6 (50%)
Ig strand G 207..215 CDD:409353 2/7 (29%)
Ig_3 219..295 CDD:404760 20/101 (20%)
putative Ig strand A 219..225 CDD:409353 1/5 (20%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/28 (7%)
Ig strand F 288..293 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.