DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and DIP-delta

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:353 Identity:139/353 - (39%)
Similarity:200/353 - (56%) Gaps:33/353 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMH 102
            :|.|...|.|||...||:|.|.|.|.:||..||.|:....|.:|.:...|::...|.|:.:.| :
  Fly    43 EPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTD-N 106

  Fly   103 TWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESS-ADLAVQEGEDATLTCKA 166
            ||.|.:::..:.|||.||||:||:||..|||.:.|.|||:|::.||: :.:||:|.::..:||:|
  Fly   107 TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171

  Fly   167 TGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVS 231
            .|.|.|::.|||||||.|.:.|.     .||..|:...|.|.::.|.:||||||||:|.|||:||
  Fly   172 DGFPAPKIIWRREDGEEIAVEKK-----KKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVS 231

  Fly   232 KRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESG 296
            ||:.|.|:|:||:..|:||:|.|.|:||.::|..||.|..:.||:        :.||        
  Fly   232 KRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWV--------YNSV-------- 280

  Fly   297 SPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHP 361
                 |:|...||......:.||..|.|.:|:....|.|.|.|:|.||||..||::|:|||.| |
  Fly   281 -----MVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPL-P 339

  Fly   362 GASASNDDHLNYIGGLEEAARNAGRSNR 389
            ...:....|..    :|....|...|:|
  Fly   340 STPSKQVTHTT----VESRENNIIPSSR 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 38/91 (42%)
Ig 47..129 CDD:299845 33/81 (41%)
Ig 140..238 CDD:299845 46/98 (47%)
IG_like 247..355 CDD:214653 37/107 (35%)
Ig 256..351 CDD:299845 30/94 (32%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 38/92 (41%)
Ig 145..238 CDD:416386 45/97 (46%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 2/3 (67%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 6/6 (100%)
Ig strand G 230..238 CDD:409353 5/7 (71%)
Ig 242..333 CDD:416386 38/111 (34%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/12 (17%)
Ig strand C' 281..283 CDD:409353 1/1 (100%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 4/9 (44%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102261at50557
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
98.970

Return to query results.
Submit another query.