DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and DIP-delta

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:353 Identity:139/353 - (39%)
Similarity:200/353 - (56%) Gaps:33/353 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMH 102
            :|.|...|.|||...||:|.|.|.|.:||..||.|:....|.:|.:...|::...|.|:.:.| :
  Fly    43 EPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTD-N 106

  Fly   103 TWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESS-ADLAVQEGEDATLTCKA 166
            ||.|.:::..:.|||.||||:||:||..|||.:.|.|||:|::.||: :.:||:|.::..:||:|
  Fly   107 TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171

  Fly   167 TGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVS 231
            .|.|.|::.|||||||.|.:.|.     .||..|:...|.|.::.|.:||||||||:|.|||:||
  Fly   172 DGFPAPKIIWRREDGEEIAVEKK-----KKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVS 231

  Fly   232 KRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESG 296
            ||:.|.|:|:||:..|:||:|.|.|:||.::|..||.|..:.||:        :.||        
  Fly   232 KRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWV--------YNSV-------- 280

  Fly   297 SPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHP 361
                 |:|...||......:.||..|.|.:|:....|.|.|.|:|.||||..||::|:|||.| |
  Fly   281 -----MVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPL-P 339

  Fly   362 GASASNDDHLNYIGGLEEAARNAGRSNR 389
            ...:....|..    :|....|...|:|
  Fly   340 STPSKQVTHTT----VESRENNIIPSSR 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 33/81 (41%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 2/3 (67%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 3/4 (75%)
Ig 141..238 CDD:472250 45/97 (46%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 4/4 (100%)
Ig strand G 231..234 CDD:409562 2/2 (100%)
IG_like 247..355 CDD:214653 37/107 (35%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 1/3 (33%)
Ig strand E 317..326 CDD:409358 4/8 (50%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 38/92 (41%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 4/7 (57%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 45/97 (46%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 4/4 (100%)
Ig strand G 231..234 CDD:409353 2/2 (100%)
Ig 242..333 CDD:472250 38/111 (34%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 4/9 (44%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 2/2 (100%)

Return to query results.
Submit another query.