DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and CG34353

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:331 Identity:94/331 - (28%)
Similarity:141/331 - (42%) Gaps:45/331 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HHES----SSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVV 88
            |.||    |.....:|.||.......:..|...:|.|.|.|.....|.|.|..  .:|......|
  Fly    71 HFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKRGI--AILTAGSVKV 133

  Fly    89 THNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLA 153
            |.:.|:.:    ::.:.|:|.....:|.|.|:|||.|...::....:::.|||.|.:..:...|.
  Fly   134 TPDPRVRL----VNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQ 194

  Fly   154 VQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAY 218
            |::|....:.|.|||||.|.|||.|::..:     |...|  |:.|:   .|.:..::|.:.|.|
  Fly   195 VKKGSSVRIECSATGNPMPNVTWSRKNNIL-----PNGEE--KLHSH---VLSIENVDRHKGGVY 249

  Fly   219 LCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSN 283
            :|.|:|.|....|.:|.|.|.|:|.:.....::.:..|.:..|.|.|.....|...|.|..    
  Fly   250 ICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDT---- 310

  Fly   284 GFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRA 348
                              |.||..:..|.|.| |.|..  |::|...|.|.|.|.||:.|.||:|
  Fly   311 ------------------MQLDTTERHIMETR-GSRHT--LIIRKVHPQDFGNYSCVAENQLGKA 354

  Fly   349 EGTLRL 354
            ..||:|
  Fly   355 RKTLQL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 21/91 (23%)
Ig 47..129 CDD:299845 21/81 (26%)
Ig 140..238 CDD:299845 32/97 (33%)
IG_like 247..355 CDD:214653 30/108 (28%)
Ig 256..351 CDD:299845 27/94 (29%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 21/85 (25%)
Ig 103..177 CDD:143165 20/79 (25%)
IG_like 191..269 CDD:214653 29/87 (33%)
IGc2 198..258 CDD:197706 23/69 (33%)
I-set 273..360 CDD:254352 30/111 (27%)
Ig 290..359 CDD:143165 27/93 (29%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.