DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and igsf9bb

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_068072154.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1448 Species:Danio rerio


Alignment Length:369 Identity:93/369 - (25%)
Similarity:137/369 - (37%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 STQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSV---RNLGKNKVGWLRASDQTVLALQ 84
            ||:....:.:..:..:|:|      ||..||...||.|.|   .|.....|.|.:........: 
Zfish    14 STRGTAAQGAHGVREEPQF------VTSRAGETVILGCDVVHPLNGQPYVVEWFKFGVPIPFFI- 71

  Fly    85 GRVVTHNARISVMHQD--------MH-TWKLKISKLRESDRGCYMCQI-----------NTSPMK 129
                  |.|....|.|        :| ...|:|.::|..|:|.|.|::           |.|.:.
Zfish    72 ------NFRFYPPHVDPEYAGRASLHGKSSLRIERVRSEDQGWYECKVLMLEQQYHTFHNGSWVH 130

  Fly   130 KQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSREL 194
                 :.|..|| ...:.....:..:||...||:|.|.|||:|.|:|.||...:        ::.
Zfish   131 -----LTVNAPP-TFTDTPPQYVEAKEGGSITLSCTAFGNPKPSVSWLREGNPV--------QDS 181

  Fly   195 MKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDV 259
            .|.:..:| ||.|:.:.|...|||.|.|.::...|| ....|.||..|.:.:|.:.:...:..|.
Zfish   182 TKYKVSDG-SLTLVSISREDRGAYTCRAYSEQGEAV-HTTRLLVQGPPFIVSPPENITVNISQDA 244

  Fly   260 QLECQVEASPSPVSY---WLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGV 321
            ...||.||.|..::|   |    ...|.|.........|      :|:||.              
Zfish   245 FFTCQAEAYPGNLTYTWFW----EEDNVFFKNDLKRRVS------ILIDGS-------------- 285

  Fly   322 MLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASA 365
              |::....|.|.|.|.|..:|||||.            |.|||
Zfish   286 --LIISQVKPEDAGKYTCSPSNSLGRP------------PSASA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 25/104 (24%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 29/96 (30%)
Ig strand B 160..164 CDD:409562 2/3 (67%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 3/4 (75%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 26/110 (24%)
Ig strand B 259..263 CDD:409358 0/3 (0%)
Ig strand C 272..276 CDD:409358 1/6 (17%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
igsf9bbXP_068072154.1 Ig 41..113 CDD:409353 19/78 (24%)
Ig strand B 41..45 CDD:409353 2/3 (67%)
Ig strand C 57..61 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
IG_like 144..223 CDD:214653 28/88 (32%)
Ig strand B 155..159 CDD:409353 2/3 (67%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 189..193 CDD:409353 3/4 (75%)
Ig strand F 203..208 CDD:409353 3/4 (75%)
Ig strand G 216..219 CDD:409353 1/3 (33%)
Ig 227..319 CDD:472250 31/127 (24%)
Ig strand B 244..248 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 284..288 CDD:409353 2/19 (11%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 312..315 CDD:409353 1/2 (50%)
Ig <343..403 CDD:472250
Ig strand C 353..358 CDD:409353
Ig strand E 378..382 CDD:409353
Ig strand F 392..397 CDD:409353
Ig 427..504 CDD:472250
Ig strand B 436..440 CDD:409353
Ig strand C 449..453 CDD:409353
Ig strand E 470..474 CDD:409353
Ig strand F 484..489 CDD:409353
FN3 <489..>734 CDD:442628
Ig strand G 497..500 CDD:409353
FN3 509..604 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.