DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-gamma and aebp1b

DIOPT Version :9

Sequence 1:	NP_651649.1	Gene:	DIP-gamma / 43417	FlyBaseID:	FBgn0039617	Length:	413	Species:	Drosophila melanogaster
Sequence 2:	XP_696022.6	Gene:	aebp1b / 567630	ZFINID:	ZDB-GENE-030131-8546	Length:	1247	Species:	Danio rerio

Alignment Length:	117	Identity:	29/117 - (24%)
Similarity:	51/117 - (43%)	Gaps:	19/117 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   122 QIN--TSPMKKQVGCIDVQVPPDIINEESSADL----------AVQEGEDATLTCKATGNPQPRV 174
            ::|  |...|.::...|.:...:..|..|..||          .::.|:...|.||.:.:.: .:
Zfish    23 EVNGLTEHSKSEISHTDREQHVEDRNVTSVEDLLQVKIIPPYATIEVGQHKQLLCKVSSDAK-NI 86

  Fly   175 TWRREDGEMILIRKPGSRELMKVESYNG--SSLRLLRLERRQMGAYLCIASN 224
            .|...:||.:| .|.|:   :||.::..  |||.:|.......|.|.|:|:|
Zfish    87 NWVSPNGEKVL-TKHGN---LKVHNHGSVLSSLTVLNANLNNAGIYKCVATN 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-gamma	NP_651649.1	IG_like	47..139	CDD:214653	4/18 (22%)
		Ig	47..129	CDD:299845	2/8 (25%)
		Ig	140..238	CDD:299845	25/97 (26%)
		IG_like	247..355	CDD:214653
		Ig	256..351	CDD:299845
aebp1b	XP_696022.6	Ig	56..147	CDD:299845	21/84 (25%)
		IG_like	62..145	CDD:214653	21/78 (27%)
		FA58C	402..555	CDD:238014
		FA58C	403..556	CDD:214572
		Peptidase_M14_like	577..1036	CDD:299699
		Peptidase_M14NE-CP-C_like	1040..1115	CDD:200604
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900