DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and hspg2

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_021325650.1 Gene:hspg2 / 565429 ZFINID:ZDB-GENE-080807-4 Length:3701 Species:Danio rerio


Alignment Length:304 Identity:78/304 - (25%)
Similarity:117/304 - (38%) Gaps:64/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRG 117
            |......|:.:  |..::.||:         :|.|:..|..|.       ...|:|..|.:|:.|
Zfish  2711 GSAVEFTCAAK--GGLQIEWLK---------EGGVLPPNHHIK-------DGILRIENLEQSNEG 2757

  Fly   118 CYMCQINTSPMKKQVGC-IDVQVPPDI-INEESSADLAVQEGEDATLTCKATGNPQPRVTWRRED 180
            .|.|::.:.....|... :.:|..|.: ||..:|.. .|..|......|.|.|:|:|.|.|.:..
Zfish  2758 IYTCRVTSQFEHAQDSAKLLIQALPKVKINVRTSVQ-TVMVGNSVEFECHAIGDPEPTVRWSKVG 2821

  Fly   181 GEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVR 245
            ..:     |...|:      .|:.||:.::.....|.|.|.|:|||....| .|.|::|..|.:.
Zfish  2822 APL-----PDHVEI------RGNILRIDQVFESDSGQYRCTATNDVGSEHS-HVVLNIQSLPQIA 2874

  Fly   246 APSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYG 310
            |..:.....:|||..|.|.....|.|...|.|               :|:..|        ||. 
Zfish  2875 ALPESKEVTIGSDAVLPCIASGYPVPTITWSK---------------VENDLP--------PKC- 2915

  Fly   311 ITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRL 354
               |:||:    .|.|...:.||.|||.|.:.|..|:.|...||
Zfish  2916 ---RQDGH----ALTVPVVTESDAGTYVCTAANKQGKVEAFTRL 2952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 16/75 (21%)
Ig strand B 56..60 CDD:409353 0/3 (0%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 28/97 (29%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653 29/108 (27%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 2/8 (25%)
Ig strand F 336..341 CDD:409358 3/4 (75%)
hspg2XP_021325650.1 SEA 84..198 CDD:470595
LDLa 216..251 CDD:238060
LDLa 277..311 CDD:238060
LDLa 317..351 CDD:238060
LDLa 360..395 CDD:238060
Ig_Perlecan_like 413..490 CDD:143220
Ig strand B 416..422 CDD:143220
Ig strand C 429..434 CDD:143220
Ig strand E 454..458 CDD:143220
Ig strand F 467..473 CDD:143220
Ig strand G 482..488 CDD:143220
Laminin_B 598..732 CDD:459652
EGF_Lam 766..814 CDD:238012
EGF_Lam 831..869 CDD:238012
Laminin_EGF 871..923 CDD:395007
Laminin_B 991..1125 CDD:459652
Laminin_EGF 1159..1206 CDD:395007
EGF_Lam 1208..1261 CDD:238012
Laminin_EGF 1272..1315 CDD:395007
Laminin_B 1536..1671 CDD:459652
EGF_Lam 1705..1754 CDD:238012
EGF_Lam 1755..1811 CDD:238012
IG_like 1823..1903 CDD:214653
Ig strand B 1834..1838 CDD:409549
Ig strand C 1847..1852 CDD:409549
Ig strand E 1870..1873 CDD:409549
Ig strand F 1883..1888 CDD:409549
Ig strand G 1896..1899 CDD:409549
IgI_Perlecan_like 1911..1996 CDD:409412
Ig strand A 1911..1915 CDD:409412
Ig strand A' 1920..1923 CDD:409412
Ig strand B 1927..1937 CDD:409412
Ig strand C 1943..1947 CDD:409412
Ig strand C' 1950..1952 CDD:409412
Ig strand D 1957..1962 CDD:409412
Ig strand E 1963..1969 CDD:409412
Ig strand F 1976..1984 CDD:409412
Ig strand G 1987..1996 CDD:409412
I-set 2025..2109 CDD:400151
Ig strand B 2042..2046 CDD:409353
Ig strand C 2055..2059 CDD:409353
Ig strand E 2075..2079 CDD:409353
Ig strand F 2089..2094 CDD:409353
Ig strand G 2102..2105 CDD:409353
I-set 2119..2231 CDD:400151
Ig strand B 2136..2140 CDD:409420
Ig strand C 2149..2153 CDD:409420
Ig strand E 2197..2201 CDD:409420
Ig strand F 2211..2216 CDD:409420
Ig strand G 2224..2227 CDD:409420
Ig 2241..2309 CDD:472250
Ig strand B 2256..2260 CDD:409353
Ig strand C 2269..2273 CDD:409353
Ig strand F 2302..2307 CDD:409353
IG_like 2339..2420 CDD:214653
Ig strand B 2350..2354 CDD:409399
Ig strand C 2364..2369 CDD:409399
Ig strand E 2386..2390 CDD:409399
Ig strand F 2400..2405 CDD:409399
Ig strand G 2415..2418 CDD:409399
IG_like 2432..2513 CDD:214653
Ig strand B 2442..2446 CDD:409353
Ig strand C 2455..2459 CDD:409353
Ig strand E 2479..2483 CDD:409353
Ig strand F 2493..2498 CDD:409353
Ig strand G 2506..2509 CDD:409353
I-set 2517..2606 CDD:400151
Ig strand B 2540..2544 CDD:409353
Ig strand C 2553..2557 CDD:409353
Ig strand E 2572..2576 CDD:409353
Ig strand F 2586..2591 CDD:409353
Ig strand G 2599..2602 CDD:409353
Ig 2610..2693 CDD:472250
Ig strand B 2627..2631 CDD:409357
Ig strand C 2640..2644 CDD:409357
Ig strand E 2659..2663 CDD:409357
Ig strand F 2673..2678 CDD:409357
Ig strand G 2686..2689 CDD:409357
Ig 2699..2778 CDD:472250 17/84 (20%)
Ig strand B 2714..2718 CDD:409549 0/3 (0%)
Ig strand C 2726..2729 CDD:409549 0/2 (0%)
Ig strand E 2744..2748 CDD:409549 1/3 (33%)
Ig strand F 2758..2763 CDD:409549 2/4 (50%)
Ig strand G 2771..2774 CDD:409549 1/2 (50%)
I-set 2785..2867 CDD:400151 27/94 (29%)
Ig strand B 2801..2805 CDD:409394 0/3 (0%)
Ig strand C 2814..2818 CDD:409394 1/3 (33%)
Ig strand E 2834..2837 CDD:409394 1/2 (50%)
Ig strand F 2847..2852 CDD:409394 2/4 (50%)
Ig strand G 2859..2862 CDD:409394 1/3 (33%)
I-set 2871..2954 CDD:400151 31/113 (27%)
Ig strand B 2888..2892 CDD:409390 1/3 (33%)
Ig strand C 2901..2905 CDD:409390 0/3 (0%)
Ig strand E 2920..2924 CDD:409390 1/7 (14%)
Ig strand F 2934..2939 CDD:409390 3/4 (75%)
Ig strand G 2947..2950 CDD:409390 1/2 (50%)
LamG 2961..3119 CDD:238058
EGF_CA <3146..3175 CDD:238011
LamG 3226..3377 CDD:238058
EGF 3402..3433 CDD:394967
EGF_CA 3441..3470 CDD:238011
LamG 3497..3671 CDD:238058
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.