DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and lrit3a

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001122166.1 Gene:lrit3a / 558559 ZFINID:ZDB-GENE-080723-63 Length:636 Species:Danio rerio


Alignment Length:135 Identity:35/135 - (25%)
Similarity:53/135 - (39%) Gaps:23/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 CIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNG 284
            |.....:...:.:|..|.....|.|...:..:.:||||:|.|.|.....|:|...|    .|::|
Zfish   230 CSGPEHLSGVLFQRAELDQC
VKPTVMTSATKITSPLGSNVLLRCDANGFPTPTLLW----TTADG 290

  Fly   285 FASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAE 349
              ||...::...|||     :|.::.|            |.:.|....|.|.|.|.:.|..|.||
Zfish   291 --SVVNNTVVQESPG-----EGVRWSI------------LSLHSIVFKDAGDYRCKAKNVAGNAE 336

  Fly   350 GTLRL 354
            ..:.|
Zfish   337 AYITL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653
Ig 47..129 CDD:299845
Ig 140..238 CDD:299845 3/17 (18%)
IG_like 247..355 CDD:214653 30/108 (28%)
Ig 256..351 CDD:299845 27/94 (29%)
lrit3aNP_001122166.1 LRR_8 81..141 CDD:290566
leucine-rich repeat 83..106 CDD:275378
LRR_4 107..145 CDD:289563
leucine-rich repeat 107..130 CDD:275378
LRR_8 129..>171 CDD:290566
LRR_4 129..170 CDD:289563
leucine-rich repeat 131..154 CDD:275378
leucine-rich repeat 155..168 CDD:275378
TPKR_C2 199..249 CDD:301599 3/18 (17%)
Ig 252..343 CDD:299845 32/113 (28%)
IG_like 261..343 CDD:214653 30/104 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.