DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and KIRREL1

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:432 Identity:91/432 - (21%)
Similarity:147/432 - (34%) Gaps:113/432 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STLFVILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVG 71
            |.|..||.::.....|:......|.:.|              |..||:.|:|.|.:.|. ...|.
Human     3 SLLVWILTLSDTFSQGTQTRFSQEPADQ--------------TVVAGQRAVLPCVLLNY-SGIVQ 52

  Fly    72 WLRASDQTVLAL-QGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCI 135
            |.:  |...|.: ||.......|: |...|...:.|:|:....||...|.||...:.::.:...:
Human    53 WTK--DGLALGMGQGLKAWPRYRV-VGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKL 114

  Fly   136 DVQVPPDIINEESSADLAVQEGEDATLTCKA-TGNPQPRVTWRREDG----------EMILIRKP 189
            .|.:||:....:....:.:|.|....|||:| ...|...:.|.| ||          |::   |.
Human   115 TVLIPPEDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFR-DGTQQEGAVASTELL---KD 175

  Fly   190 GSRELMKVE-SYNGSSLRLLRLERRQMGAYLCIASND-VPPAVSKRVSLSVQFAPMVRAPSQLLG 252
            |.||....: ..|.:.|.:.|:       :.|.:.|: :|......:.|.|...|.|....:...
Human   176 GKRETTVSQLLINPTDLDIGRV-------FTCRSMNEAIPSGKETSIELDVHHPPTVTLSIEPQT 233

  Fly   253 TPLGSDVQLECQVEASPSPVSY-WLKG--------------------------ARTSNGFASVST 290
            ...|..|...||..|:|..:.| |.||                          ....|...|.:.
Human   234 VQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNV 298

  Fly   291 ASLESGSPGPEMLLDGPKYGITE----------------------RRDGYRGVM----------- 322
            ::|.:....|.:::| ||...|:                      ::|...|..           
Human   299 STLVNVHFAPRIVVD-PKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALS 362

  Fly   323 --------LLVVRSFSPSDVGTYHC-VSTNSLGRAEGTLRLY 355
                    .|:::|.:.:|.|||.| .....:|.||..:.||
Human   363 AQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLY 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 24/92 (26%)
Ig 47..129 CDD:299845 23/82 (28%)
Ig 140..238 CDD:299845 25/110 (23%)
IG_like 247..355 CDD:214653 30/176 (17%)
Ig 256..351 CDD:299845 30/163 (18%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 25/111 (23%)
Ig 25..116 CDD:299845 25/108 (23%)
Ig2_KIRREL3-like 138..219 CDD:143236 21/91 (23%)
I-set 223..304 CDD:254352 15/80 (19%)
Ig_2 227..305 CDD:290606 13/77 (17%)
Ig_2 311..405 CDD:290606 18/95 (19%)
IG_like 314..405 CDD:214653 17/91 (19%)
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.