DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Ntm

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_017451354.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:374 Identity:102/374 - (27%)
Similarity:160/374 - (42%) Gaps:52/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMH 102
            |..|...::|||...|..|.|.|::.| ...:|.||..|  |:|.........:.|:.::.....
  Rat    35 DATFPKAMDNVTVRQGESATLRCTIDN-RVTRVAWLNRS--TILYAGNDKWCLDPRVVLLSNTQT 96

  Fly   103 TWKLKISKLRESDRGCYMCQINTS--PMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCK 165
            .:.::|..:...|.|.|.|.:.|.  |...:|..| |||.|.|:  |.|:|:::.||.:.:|||.
  Rat    97 QYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLI-VQVSPKIV--EISSDISINEGNNISLTCI 158

  Fly   166 ATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAV 230
            |||.|:|.||||.        ..|.:...:..:.|    |.:..:.|.|.|.|.|.|||||...|
  Rat   159 ATGRPEPTVTWRH--------ISPKAVGFVSEDEY----LEIQGITREQSGEYECSASNDVAAPV 211

  Fly   231 SKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLES 295
            .:||.::|.:.|.: :.::..|.|:|....|:|:..|.||....|.|                  
  Rat   212 VRRVKVTVNYPPYI-SEAKGTGVPVGQKGTLQCEASAVPSAEFQWFK------------------ 257

  Fly   296 GSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLH 360
               ..:.|::|.|....|.|.   .:..|...:.|..|.|.|.||::|.||....::.|:|:...
  Rat   258 ---DDKRLVEGKKGVKVENRP---FLSRLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEP 316

  Fly   361 PGASASNDDHLNYI------GGLEEAARNAGRSNRTTW-QPLLAMLMLL 402
            ..::...:.....:      |.:.|......|.....| .|||.:.:||
  Rat   317 TSSTLLQEVKTTALTPWKGPGAVSEVNNGTSRRAGCIWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/93 (27%)
Ig 47..129 CDD:299845 22/83 (27%)
Ig 140..238 CDD:299845 35/97 (36%)
IG_like 247..355 CDD:214653 25/107 (23%)
Ig 256..351 CDD:299845 23/94 (24%)
NtmXP_017451354.1 Ig 44..132 CDD:416386 24/91 (26%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 1/4 (25%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 3/13 (23%)
Ig strand C' 72..76 CDD:409353 2/5 (40%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 6/33 (18%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 2/7 (29%)
Ig_3 136..205 CDD:404760 28/82 (34%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand F 197..205 CDD:409353 4/7 (57%)
Ig 223..307 CDD:416386 26/108 (24%)
putative Ig strand A 223..229 CDD:409353 1/6 (17%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.