DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr12

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:268 Identity:72/268 - (26%)
Similarity:112/268 - (41%) Gaps:45/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGK-----NKVGWLRASDQT 79
            |.....|....|.|.:..|.|.:.  :|.|...|..|.|.|.|..:.:     |::.|:|..|..
  Fly    61 GDSKLDNNLDSSDSPMFEDSELMA--HNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWH 123

  Fly    80 VLALQGRVVTHNARISVMH-QDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDI 143
            :|:...::.|::.|.:::| ...:.|.|:|..::..|.|.|.||::|     ..|.|...|...:
  Fly   124 ILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVST-----PTGIISHFVNLQV 183

  Fly   144 INEES----SADLAVQEGEDATLTCKATGNPQP--RVTWRREDGEMILIRKPGSRELMKVESYNG 202
            :..|:    |.:|.|..|....|.|....:|.|  .|.|::.|.   ||....||..:.:|:..|
  Fly   184 VVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDR---LINYVDSRRDITIETTPG 245

  Fly   203 --SSLRLLRLERR--QMGAYLCIASNDVP-------------PAVSKRVSLSVQ-----FAPMVR 245
              :..||:..|.:  ..|.|.|.|||..|             .|:|:|.:.|..     |..|: 
  Fly   246 PRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSML- 309

  Fly   246 APSQLLGT 253
            ||..||.|
  Fly   310 APCLLLNT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 24/87 (28%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 31/119 (26%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 0/3 (0%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653 4/7 (57%)
Ig strand B 259..263 CDD:409358
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
dpr12NP_652462.3 IG_like 86..183 CDD:214653 27/101 (27%)
Ig strand B 95..99 CDD:409353 2/3 (67%)
Ig strand C 109..117 CDD:409353 1/7 (14%)
Ig strand E 149..153 CDD:409353 2/3 (67%)
Ig strand F 163..168 CDD:409353 2/4 (50%)
Ig strand G 176..179 CDD:409353 0/2 (0%)
Ig_3 195..271 CDD:464046 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.