DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and cadm2

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_031751706.1 Gene:cadm2 / 448238 XenbaseID:XB-GENE-998536 Length:441 Species:Xenopus tropicalis


Alignment Length:374 Identity:94/374 - (25%)
Similarity:154/374 - (41%) Gaps:78/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLQSTLFVILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKN 68
            |..|:|:.:::.|     .|.:|:        .|.........|||...|....|.|.|......
 Frog     9 LCLSSLWGVIVQA-----ASPRNK--------KPSQGQFPVTQNVTVVEGGTINLTCRVDQNDNT 60

  Fly    69 KVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVG 133
            .:.|...:.|| |....:....:.||.::....|...:.||.:..||.|.|.|.:.|.|:|....
 Frog    61 SLQWSNPAQQT-LYFDDKKALRDNRIELVRASWHELSISISDVSLSDEGQYTCSLFTMPVKTSKA 124

  Fly   134 CIDVQVPPDIINEESSADLA-VQEGEDATLTCKATGN-PQPRVTWRREDGEMILIRKPGSRELMK 196
            .:.|...|:  |...|...: |.||:...||||::|: |...:.|.:.|.|:..::|      ::
 Frog   125 YLMVLGVPE--NPHISGFTSPVMEGDTIQLTCKSSGSKPAADIRWFKNDQEITDVQK------IQ 181

  Fly   197 VESYNG------SSLRLLRLERRQMGAYL-CIASND---VPPAVSKRVSLSVQFAPMVRAPSQLL 251
            .:..||      ||| :.:.:|:..||.: |...::   ..|.::|:| |.:.:.|.||.   |.
 Frog   182 QQDSNGKTFTVTSSL-VFQGDRKDDGAVIRCRVDHESLTSTPQIAKQV-LEIHYTPTVRI---LP 241

  Fly   252 GTPL---GSDVQLECQVEASPSPVS-YWLKGARTSNGFASVSTASLESGS-PGPE-MLLDGPKYG 310
            .|||   |..:.|.|:.:..|.|.. .|.|                :.|. |.|| |.::|.:  
 Frog   242 STPLPQEGQPLILICESKGKPLPEPVLWTK----------------DGGELPDPERMTVNGRE-- 288

  Fly   311 ITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGR--AEGTLRLYEI 357
                         |.:...:.:|.|||.|.:|||:|:  ||..|.:.::
 Frog   289 -------------LTISFLNKTDNGTYRCEATNSIGQSSAEYVLIINDV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 23/81 (28%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 0/3 (0%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 29/108 (27%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 3/3 (100%)
Ig strand F 217..222 CDD:409562 2/5 (40%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653 30/115 (26%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/4 (0%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 3/4 (75%)
cadm2XP_031751706.1 IgV_1_Necl-3 34..129 CDD:409498 24/95 (25%)
Ig strand A 34..37 CDD:409498 0/2 (0%)
FR1 35..53 CDD:409498 5/17 (29%)
Ig strand A' 38..44 CDD:409498 3/5 (60%)
Ig strand B 46..54 CDD:409498 2/7 (29%)
CDR1 54..59 CDD:409498 1/4 (25%)
FR2 60..67 CDD:409498 1/6 (17%)
Ig strand C 60..66 CDD:409498 1/5 (20%)
CDR2 68..79 CDD:409498 3/11 (27%)
Ig strand C' 70..74 CDD:409498 3/4 (75%)
Ig strand C' 76..79 CDD:409498 0/2 (0%)
FR3 80..115 CDD:409498 10/34 (29%)
Ig strand D 84..91 CDD:409498 2/6 (33%)
Ig strand E 94..100 CDD:409498 0/5 (0%)
Ig strand F 107..115 CDD:409498 3/7 (43%)
CDR3 116..119 CDD:409498 1/2 (50%)
Ig strand G 119..129 CDD:409498 1/9 (11%)
FR4 121..128 CDD:409498 0/6 (0%)
IgI_2_Necl-3 128..231 CDD:409467 30/112 (27%)
Ig strand A 129..132 CDD:409467 0/2 (0%)
Ig strand A' 135..139 CDD:409467 0/3 (0%)
Ig strand B 148..158 CDD:409467 4/9 (44%)
Ig strand C 161..170 CDD:409467 2/8 (25%)
Ig strand C' 171..174 CDD:409467 1/2 (50%)
Ig strand D 176..183 CDD:409467 1/12 (8%)
Ig strand E 189..199 CDD:409467 3/10 (30%)
Ig strand F 207..215 CDD:409467 2/7 (29%)
Ig strand G 223..230 CDD:409467 2/7 (29%)
Ig_3 235..308 CDD:464046 26/106 (25%)
4.1m 394..412 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.