DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and robo2

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster


Alignment Length:421 Identity:100/421 - (23%)
Similarity:144/421 - (34%) Gaps:133/421 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NVTYPAGREAILACSV-RNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISK 110
            |.....|..|::.|.. |...:.::.| |.:.|| |.|.|     |.||.::...    .|.|.:
  Fly   197 NTRVAQGEVALMECGAPRGSPEPQISW-RKNGQT-LNLVG-----NKRIRIVDGG----NLAIQE 250

  Fly   111 LRESDRGCYMCQINTSPMKKQVGC-------IDVQVPPDIINEESSADLAVQEGEDATLTCKATG 168
            .|:||.|.|.|.:     |..||.       :.|.|.|.:|....:....|  |......|:..|
  Fly   251 ARQSDDGRYQCVV-----KNVVGTRESATAFLKVHVRPFLIRGPQNQTAVV--GSSVVFQCRIGG 308

  Fly   169 NPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKR 233
            :|.|.|.|||       ....|:..|.:|......||:|..:....||.|.|.|.|.|....:..
  Fly   309 DPLPDVLWRR-------TASGGNMPLRRVHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATG 366

  Fly   234 VSLSVQFAP--MVRAPSQLLGTPLGSDVQLECQVEASPSPVSYW---------LKGARTS----- 282
            : |:|...|  ::|..:||:  .:|.:|..|||....|.|..||         |.|.|..     
  Fly   367 I-LTVHAPPKFVIRPKNQLV--EIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVT 428

  Fly   283 ----------------------------NGFASVSTASLES------------------------ 295
                                        |...|||:.::.|                        
  Fly   429 LTPEGRSVLSIARFAREDSGKVVTCNALNAVGSVSSRTVVSVDTQFELPPPIIEQGPVNQTLPVK 493

  Fly   296 ----------GSPGPEM--LLDGPKYGIT--ERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLG 346
                      |:|.|::  .|||....:.  |||:......|.:.......|.|.|.||::|..|
  Fly   494 SIVVLPCRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNG 558

  Fly   347 RA--EGTLRL-------------YEIKLHPG 362
            ::  .|.|||             .|:..:||
  Fly   559 KSSWSGYLRLDTPTNPNIKFFRAPELSTYPG 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 27/99 (27%)
Ig 47..129 CDD:299845 23/82 (28%)
Ig 140..238 CDD:299845 26/97 (27%)
IG_like 247..355 CDD:214653 40/202 (20%)
Ig 256..351 CDD:299845 34/176 (19%)
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317
I-set 91..184 CDD:254352
I-set 190..279 CDD:254352 26/97 (27%)
Ig2_Robo 193..279 CDD:143201 26/97 (27%)
I-set 283..370 CDD:254352 26/96 (27%)
Ig 300..370 CDD:299845 22/77 (29%)
Ig 388..>457 CDD:299845 12/68 (18%)
I-set 479..561 CDD:254352 17/81 (21%)
Ig 496..561 CDD:143165 17/64 (27%)
FN3 588..681 CDD:238020 2/2 (100%)
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.