DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr17

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:272 Identity:59/272 - (21%)
Similarity:101/272 - (37%) Gaps:69/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMH--TWKLKIS 109
            |:|...|..|.:.|.:..|....|.|:|..|..::::.......:.|...::|:.|  ||.|:|.
  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478

  Fly   110 KLRESDRGCYMCQINTSP-MKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTC--KATGNPQ 171
            .:..||.|.|.||:.|.| :..:|....|:...::|.::|.   .|:.|....|.|  :.|.:|.
  Fly   479 YVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSR---FVKAGSKVALHCIVRGTLDPP 540

  Fly   172 PRVTWRREDGEMILIRKPGSRELMKVESYNG--------------------SSLRLLRLERRQMG 216
            ..:.|.|           |.:::...:...|                    .||.:..:.:...|
  Fly   541 KYIIWFR-----------GQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSG 594

  Fly   217 AYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGART 281
            .|.|..||.|..:|...| ||.::     :.|.::.|                        .|||
  Fly   595 NYTCQPSNSVSVSVDLHV-LSGEY-----SASAIMST------------------------AART 629

  Fly   282 SNGFASVSTASL 293
            :.|..|...::|
  Fly   630 TKGGRSTCHSTL 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 27/94 (29%)
Ig 47..129 CDD:299845 25/84 (30%)
Ig 140..238 CDD:299845 23/119 (19%)
IG_like 247..355 CDD:214653 8/47 (17%)
Ig 256..351 CDD:299845 6/38 (16%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 21/76 (28%)
Ig 415..507 CDD:299845 25/91 (27%)
IG_like 521..612 CDD:214653 19/101 (19%)
IGc2 524..605 CDD:197706 16/91 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.