DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr5

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:279 Identity:81/279 - (29%)
Similarity:116/279 - (41%) Gaps:33/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKLLQSTLFVILIM-----ATKCGSGSTQNQHH----ESSSQLDP------DPEFIGFINNVTYP 51
            |.|::..:.:::||     ..|....|:|...|    |..|.|.|      ||.|....:.....
  Fly    38 EMLVEYFMALLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIA 102

  Fly    52 A-GREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQD-MHTWKLKISKLRES 114
            | |..|.|.|.||:||...|.|:|..|..:|.:.....|::.|....|.| ...|.|||..:::.
  Fly   103 ALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQR 167

  Fly   115 DRGCYMCQINTSP-----MKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQP-- 172
            |.|.|.||::|.|     .|..|.....|:   :.|.|    |.:|.|.|..|||.|...|.|  
  Fly   168 DAGVYECQVSTEPKISLAYKLVVVTSKAQI---LANRE----LFIQSGSDINLTCIAPQAPGPYT 225

  Fly   173 RVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLS 237
            .:.|.: |.|::.....|...:...:....|:|.:.|::....|.|.|.|.|....:|...:..|
  Fly   226 HMLWHK-DTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKS 289

  Fly   238 VQFAPMV-RAPSQLLGTPL 255
            .|.|.|. ...|:||..||
  Fly   290 EQHAAMQHELGSRLLLPPL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 31/98 (32%)
Ig 47..129 CDD:299845 29/88 (33%)
Ig 140..238 CDD:299845 25/99 (25%)
IG_like 247..355 CDD:214653 5/9 (56%)
Ig 256..351 CDD:299845 81/279 (29%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 30/95 (32%)
IG_like 98..179 CDD:214653 27/80 (34%)
IG_like 206..278 CDD:214653 21/72 (29%)
Ig 211..278 CDD:143165 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.