DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr11

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:373 Identity:76/373 - (20%)
Similarity:109/373 - (29%) Gaps:148/373 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DPEFIGF-INNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDM 101
            :|...|: .:|||...|..|.|.|.|:.||...|.|:|..|..:|.:...|...:.|...:.|..
  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPD 180

  Fly   102 HTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKA 166
            ..|.|:|..::..|.|.|.||::|.                                        
  Fly   181 KYWTLQIKYVQARDAGSYECQVSTE---------------------------------------- 205

  Fly   167 TGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVS 231
                                                                         |.||
  Fly   206 -------------------------------------------------------------PKVS 209

  Fly   232 KRVSLSVQFAPMVRAPSQLLGTP-----LGSDVQLECQVEASPSPVSY--WLKGARTSNGFASVS 289
            .||.|.|     |...:::||.|     .||:|.|.|.|..:..|.::  |..||......:...
  Fly   210 ARVQLQV-----VVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRH 269

  Fly   290 TASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRL 354
            ...|:...|             ....:|...:..|::.|....|.|.|.|..:||          
  Fly   270 RTQLDPNLP-------------EASGEGQSTIGSLIIESAKKRDTGNYTCSPSNS---------- 311

  Fly   355 YEIKLHPGASASNDDHLNYIGGLEEAARNAGRSNRTTWQPLLAMLMLL 402
                  |.|:.:    ||.|.| |.:|.....|..||....|::|.||
  Fly   312 ------PSATVT----LNIING-ESSASAVTSSAATTRAYALSILALL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 27/91 (30%)
Ig 47..129 CDD:299845 27/81 (33%)
Ig 140..238 CDD:299845 6/97 (6%)
IG_like 247..355 CDD:214653 24/114 (21%)
Ig 256..351 CDD:299845 21/96 (22%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 33/191 (17%)
Ig 127..217 CDD:299845 33/195 (17%)
IG_like 227..320 CDD:214653 25/125 (20%)
IGc2 234..311 CDD:197706 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.