DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and LSAMP

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:333 Identity:99/333 - (29%)
Similarity:138/333 - (41%) Gaps:72/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NNVTYPAGREAILACSVRNLGKN-KVGWLRAS-------DQTVLALQGRVVTHNARISVMHQDMH 102
            :|:|...|..|||.|.|.:  || ||.||..|       |:..|         :.|:.:..:...
Human    39 DNITVRQGDTAILRCVVED--KNSKVAWLNRSGIIFAGHDKWSL---------DPRVELEKRHSL 92

  Fly   103 TWKLKISKLRESDRGCYMCQINT--SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCK 165
            .:.|:|.|:...|.|.|.|.:.|  .|...||..| |||||.|.|  .|:|:.|.||.:.||.|.
Human    93 EYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLI-VQVPPKISN--ISSDVTVNEGSNVTLVCM 154

  Fly   166 ATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAV 230
            |.|.|:|.:|||.        ..|..||....|.|    |.:|.:.|.|.|.|.|.|:|:|..|.
Human   155 ANGRPEPVITWRH--------LTPTGREFEGEEEY----LEILGITREQSGKYECKAANEVSSAD 207

  Fly   231 SKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKG---ARTSNGFASVSTAS 292
            .|:|.::|.:.|.: ..|:......|....|:|:..|.|:|...|.:.   ..::||....||  
Human   208 VKQVKVTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKST-- 269

  Fly   293 LESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEI 357
                                      .|...|.|.:.:....|.|.||:.|.||....:|.|::.
Human   270 --------------------------EGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKR 308

  Fly   358 KL----HP 361
            .|    ||
Human   309 VLPTIPHP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 31/101 (31%)
Ig 47..129 CDD:299845 27/91 (30%)
Ig 140..238 CDD:299845 37/97 (38%)
IG_like 247..355 CDD:214653 23/110 (21%)
Ig 256..351 CDD:299845 21/97 (22%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 30/100 (30%)
Ig 132..215 CDD:386229 36/96 (38%)
Ig_3 219..294 CDD:372822 20/103 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.