DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and CG7166

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:393 Identity:104/393 - (26%)
Similarity:160/393 - (40%) Gaps:92/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DPD---PEFI--GFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARIS 95
            ||.   |:|:  |.:..|.  .|....|.|.|:|||...:.|.:.|  :||......:|.:.|..
  Fly    33 DPPTTAPKFLSRGHLYKVI--VGETIELPCKVQNLGSFVLLWRKGS--SVLTAGHLKITRDQRFK 93

  Fly    96 VMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDA 160
            ::..    :.|:|:.::..|.|.|:||:.....:.||..:::.|||.:.....:..:..::|...
  Fly    94 IVGD----YNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTV 154

  Fly   161 TLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASND 225
            ||.|||:|||.|.:.|.::|    :...|       ....:.|:|.|..::|...|.|.|.|.|.
  Fly   155 TLECKASGNPVPTIFWFKKD----VFSGP-------THLSDSSTLILENVDRHHAGTYQCSADNG 208

  Fly   226 VPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVST 290
            |...||..:.|::...|.:......:....|.||:|.|.|....:....|.:     |.|     
  Fly   209 VKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQ-----NSF----- 263

  Fly   291 ASLESGSPGPEMLLDGPKYGITERR------DGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAE 349
                        |||.     |:||      |.|.    |::|:|.|:|.|.|.||:.|:|||  
  Fly   264 ------------LLDA-----TDRRSMYPRDDRYS----LIIRNFQPTDFGNYSCVADNALGR-- 305

  Fly   350 GTLRLYEIKLHPG-------ASASNDDHLNYIGGLEEAARNAGRSNRTTWQ----PLLAMLMLLW 403
             |.:..|:...||       |.:...||.|                 .||.    |.|..:.||:
  Fly   306 -TKKYIEVSGRPGPADFISPALSGFLDHYN-----------------LTWTIESIPPLDEIKLLY 352

  Fly   404 MRL 406
            .||
  Fly   353 RRL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 23/91 (25%)
Ig 47..129 CDD:299845 21/81 (26%)
Ig 140..238 CDD:299845 28/97 (29%)
IG_like 247..355 CDD:214653 31/113 (27%)
Ig 256..351 CDD:299845 30/100 (30%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 23/90 (26%)
Ig 56..116 CDD:143165 17/65 (26%)
IG_like 144..221 CDD:214653 26/87 (30%)
IGc2 151..209 CDD:197706 22/68 (32%)
IG_like 232..313 CDD:214653 32/114 (28%)
Ig 242..311 CDD:143165 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.