DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and IGLON5

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:384 Identity:102/384 - (26%)
Similarity:151/384 - (39%) Gaps:80/384 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARIS 95
            |...|....||....:|.|...|..|.|:|.: :....:|.||..|:  :|.......|.:.|:.
Human    25 SRGLLSQSLEFNSPADNYTVCEGDNATLSCFI-DEHVTRVAWLNRSN--ILYAGNDRWTSDPRVR 86

  Fly    96 VMHQDMHTWKLKISKLRESDRGCYMCQINT--SPMKKQVGCIDVQVPPDIINEESSADLAVQEGE 158
            ::......:.:.|:::...|.|.|.|...|  .|...||..| |.||..|:|  .|:.:.|.||.
Human    87 LLINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLI-VHVPARIVN--ISSPVTVNEGG 148

  Fly   159 DATLTCKATGNPQPRVTWRR-EDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIA 222
            :..|.|.|.|.|:|.||||: .||                .:..|..|.:..::|.|.|.|.|:.
Human   149 NVNLLCLAVGRPEPTVTWRQLRDG----------------FTSEGEILEISDIQRGQAGEYECVT 197

  Fly   223 SNDVPPAV-SKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFA 286
            .|.|..|. |:||.::|.:.|.:...:. ..|.||....|.|:..|.|.....|.|..|      
Human   198 HNGVNSAPDSRRVLVTVNYPPTITDVTS-ARTALGRAALLRCEAMAVPPADFQWYKDDR------ 255

  Fly   287 SVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGT 351
                           :|..|...|:..:.:..|.::|..  :.|....|.|.|.:.|.||.:..:
Human   256 ---------------LLSSGTAEGLKVQTERTRSMLLFA--NVSARHYGNYTCRAANRLGASSAS 303

  Fly   352 LRLYEIKLHPGASASNDDHLNYIGGLEEAA-RNAGRSNRTTWQPLLAMLML---LWMRL 406
            :||    |.||:             ||.:| |..|         |||:|..   ||.|:
Human   304 MRL----LRPGS-------------LENSAPRPPG---------LLALLSALGWLWWRM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 24/93 (26%)
Ig 47..129 CDD:299845 20/83 (24%)
Ig 140..238 CDD:299845 32/99 (32%)
IG_like 247..355 CDD:214653 23/107 (21%)
Ig 256..351 CDD:299845 20/94 (21%)
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 23/91 (25%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 3/6 (50%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 2/11 (18%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 7/34 (21%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 4/9 (44%)
FR4 122..129 CDD:409353 3/7 (43%)
Ig_3 134..199 CDD:404760 25/82 (30%)
Ig strand B 148..157 CDD:409353 2/8 (25%)
Ig strand C 162..170 CDD:409353 5/7 (71%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig strand G 202..212 CDD:409353 4/9 (44%)
Ig_3 217..295 CDD:404760 20/101 (20%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.