DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr10

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:285 Identity:64/285 - (22%)
Similarity:106/285 - (37%) Gaps:66/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQSTLFVILIMATKCGSGSTQNQHHESSSQLDP---------------DPEF-IGFINNVTYPAG 53
            |.:.||..|.....|....:.:.::.::::..|               :|.| :....|:|...|
  Fly     4 LWTALFCCLTGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVG 68

  Fly    54 REAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISV-MHQDMHTWKLKISKLRESDRG 117
            :.|.|.|.|::||...|.|:|..|..:|.:.....|.:.|... .|:|:..|.|:|...::.|.|
  Fly    69 KSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAG 133

  Fly   118 CYMCQINTSPMKKQ------VGCIDVQVPPDII--------------------NEE--------- 147
            .|.|||:|.|::..      |..||.:. .||:                    |:|         
  Fly   134 VYECQISTQPVRSYSVNLNIVDLIDAET-SDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQ 197

  Fly   148 ----------SSADLAVQEGEDATLTCKATGNPQP--RVTWRREDGEMILIRKPGSRELMKVESY 200
                      ...||.|.:|....|||....:|:|  .:.|..:|..:......|..:...::|.
  Fly   198 TVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSE 262

  Fly   201 NGSSLRLL-RLERRQMGAYLCIASN 224
            ...|:.|: ..:....|.|.|..||
  Fly   263 ETKSILLIYDADLLHSGKYSCYPSN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 29/82 (35%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 24/126 (19%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562
IG_like 247..355 CDD:214653
Ig strand B 259..263 CDD:409358
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
dpr10NP_729591.1 Ig 53..138 CDD:472250 26/84 (31%)
Ig strand B 71..75 CDD:409371 2/3 (67%)
Ig strand E 120..124 CDD:409371 2/3 (67%)
Ig_3 214..287 CDD:464046 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.