DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and TMIGD1

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_996663.1 Gene:TMIGD1 / 388364 HGNCID:32431 Length:262 Species:Homo sapiens


Alignment Length:252 Identity:53/252 - (21%)
Similarity:100/252 - (39%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFVILIMATKCGS------GSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRN-LG 66
            |.|||.:..:..|      |.|:|.      .||..|             |.:|.|.|:|:| ..
Human    16 LLVILFLPREMTSSVLTVNGKTENY------ILDTTP-------------GSQASLICAVQNHTR 61

  Fly    67 KNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRG-CYMCQINTSPMKK 130
            :.::.|.|.        :|||...:.      ..:::..:.:|.:.|:|.| .:.|::.......
Human    62 EEELLWYRE--------EGRVDLKSG------NKINSSSVCVSSISENDNGISFTCRLGRDQSVS 112

  Fly   131 QVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELM 195
            ....::|..||.:...:..   .|:||.:..|.|....|||.::.|.: :..::.:.|...:...
Human   113 VSVVLNVTFPPLLSGNDFQ---TVEEGSNVKLVCNVKANPQAQMMWYK-NSSLLDLEKSRHQIQQ 173

  Fly   196 KVESYNGSSLRLLRLERRQMGAYLCIASNDVPP------AVSKRVSLSVQFAPMVRA 246
            ..||:   .|.:.::|:...|.|.|||.:.:..      .:.|..::.|...|::.|
Human   174 TSESF---QLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVPIEPIIAA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 17/93 (18%)
Ig 47..129 CDD:299845 16/83 (19%)
Ig 140..238 CDD:299845 22/103 (21%)
IG_like 247..355 CDD:214653 53/252 (21%)
Ig 256..351 CDD:299845
TMIGD1NP_996663.1 IG 131..212 CDD:214652 19/87 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.