DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and TMIGD1

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_996663.1 Gene:TMIGD1 / 388364 HGNCID:32431 Length:262 Species:Homo sapiens


Alignment Length:252 Identity:53/252 - (21%)
Similarity:100/252 - (39%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFVILIMATKCGS------GSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRN-LG 66
            |.|||.:..:..|      |.|:|.      .||..|             |.:|.|.|:|:| ..
Human    16 LLVILFLPREMTSSVLTVNGKTENY------ILDTTP-------------GSQASLICAVQNHTR 61

  Fly    67 KNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRG-CYMCQINTSPMKK 130
            :.::.|.|.        :|||...:.      ..:::..:.:|.:.|:|.| .:.|::.......
Human    62 EEELLWYRE--------EGRVDLKSG------NKINSSSVCVSSISENDNGISFTCRLGRDQSVS 112

  Fly   131 QVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELM 195
            ....::|..||.:...:..   .|:||.:..|.|....|||.::.|.: :..::.:.|...:...
Human   113 VSVVLNVTFPPLLSGNDFQ---TVEEGSNVKLVCNVKANPQAQMMWYK-NSSLLDLEKSRHQIQQ 173

  Fly   196 KVESYNGSSLRLLRLERRQMGAYLCIASNDVPP------AVSKRVSLSVQFAPMVRA 246
            ..||:   .|.:.::|:...|.|.|||.:.:..      .:.|..::.|...|::.|
Human   174 TSESF---QLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVPIEPIIAA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 16/83 (19%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 0/3 (0%)
Ig strand F 118..123 CDD:409353 1/4 (25%)
Ig 141..238 CDD:472250 21/102 (21%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653 53/252 (21%)
Ig strand B 259..263 CDD:409358
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
TMIGD1NP_996663.1 IG_like 131..212 CDD:214653 19/87 (22%)
Ig strand B 139..143 CDD:409353 1/3 (33%)
Ig strand C 152..156 CDD:409353 0/3 (0%)
Ig strand E 178..182 CDD:409353 1/6 (17%)
Ig strand F 192..197 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.