DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and babos

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:135 Identity:37/135 - (27%)
Similarity:51/135 - (37%) Gaps:14/135 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QNQHHESSSQLDPDP---EFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGR 86
            ::|...|.....|:|   |.|....:||...|.:.:|.|.|   |.|    |.:||..||...|.
  Fly    45 EDQSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDV---GSN----LHSSDVVVLWYFGD 102

  Fly    87 VVTHNARISVMHQ---DMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEES 148
            .|..|.:..|...   |.: :.|.|.|......|.|:|::..|...........:...|.|..||
  Fly   103 NVISNGKNLVQPNFKLDAN-YDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAIAPES 166

  Fly   149 SADLA 153
            |...|
  Fly   167 STSAA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/94 (27%)
Ig 47..129 CDD:299845 25/84 (30%)
Ig 140..238 CDD:299845 6/14 (43%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
babosNP_001286719.1 ig 70..154 CDD:278476 25/91 (27%)
IG_like 70..154 CDD:214653 25/91 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.