DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and wrapper

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:320 Identity:93/320 - (29%)
Similarity:140/320 - (43%) Gaps:64/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LKISKLRESDRGCYMCQINT-SPMKKQVGCIDVQVPPDIINEESSADLAVQE-GEDATLTCKATG 168
            |:::.::.||.|.|.|::|: |....|...|:||:.|.::.|.|  ||..|. |....:.|:|.|
  Fly    96 LQVANVQSSDTGDYYCEMNSDSGHVVQQH
AIEVQLAPQVLIEPS--DLTEQRIGAIFEVVCEAQG 158

  Fly   169 NPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDV-PPAVSK 232
            .|||.:|||. :|.:|   :|.|      .:.|..||.|....|.|.|...|:|||.| .|||: 
  Fly   159 VPQPVITWRL-NGNVI---QPQS------NTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVA- 212

  Fly   233 RVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLK-------GARTSNGFASVST 290
            .|.|.|.|:|.|..|..::.|.|||...|||.|||:|:....|..       ||.::...:.:.|
  Fly   213 NVYLHVL
FSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQT 277

  Fly   291 ASLESGSPGPEMLLDGPKYGITERRDGYRGVM--LLVVRSFSPSDVGTYHCVSTNSLGRAEGTLR 353
                                 ....|.|...:  :|||:|...:|:|.|.|.::|.:....|::.
  Fly   278 ---------------------NRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVE 321

  Fly   354 LYE------IKLHPGASASNDDHLNY------------IGGLEEAARNAGRSNRTTWQPL 395
            |..      .|::||..:|....|.:            :...:..:.|..|..||.|..|
  Fly   322 LTGRPMPCLFKINPGTQSSTSHVLVWQTESLLPIMEFKLKFRQIPSNNVTRQVRTNWTEL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 11/33 (33%)
Ig 47..129 CDD:299845 8/23 (35%)
Ig 140..238 CDD:299845 37/99 (37%)
IG_like 247..355 CDD:214653 28/116 (24%)
Ig 256..351 CDD:299845 24/103 (23%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 9/27 (33%)
IG_like 41..118 CDD:214653 7/21 (33%)
IG_like 145..218 CDD:214653 31/83 (37%)
Ig 147..219 CDD:299845 31/82 (38%)
I-set 224..323 CDD:254352 29/119 (24%)
IGc2 236..314 CDD:197706 24/98 (24%)
FN3 339..431 CDD:238020 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.