DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Cadm4

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001040572.1 Gene:Cadm4 / 365216 RGDID:1304722 Length:388 Species:Rattus norvegicus


Alignment Length:411 Identity:91/411 - (22%)
Similarity:144/411 - (35%) Gaps:104/411 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRA 75
            ::|:.|...|.|:.|....|                |||...|..|.:.|.:.....:.|.....
  Rat    11 LLLLWAAAAGPGTAQEVQTE----------------NVTVAEGGVAEITCRLHQYDGSIVVIQNP 59

  Fly    76 SDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVP 140
            :.|| |...|.....:.|..:........::::|..|..|.|.|.||:.|.....|:..:.|.|.
  Rat    60 ARQT-LFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVA 123

  Fly   141 PD--IINEESSADLAVQEGEDATLTCKA-TGNPQPRVTWRREDGEMILIRKPGSRELMKVES--Y 200
            |:  ::.....|    .||.:..|:|.. ...|...:.|.|:           .:||..|.|  .
  Rat   124 PENPVVEVREQA----VEGGEVELSCLVPRSRPAAVLRWYRD-----------RKELKGVSSGQE 173

  Fly   201 NG------SSLRLLRLERRQMGA-YLCIASND-VPPAVSKRVS--LSVQFAPMVRAPSQLLGTPL 255
            ||      |::| .|::|:..|. .:|.|.|. :|...||:..  |.||::|..|..:.......
  Rat   174 NGKVWSVASTVR-FRVDRKDDGGIVICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVRE 237

  Fly   256 GSDVQLECQVEASPSPVSY-WLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYR 319
            |..:.|.|.|..:|.|... |.:|..:                             :.||.:...
  Rat   238 GDTLVLTCAVTGNPRPNQIRWNRGNES-----------------------------LPERAEALG 273

  Fly   320 GVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLH-PGASASNDDHLNY--IGGLEEAA 381
            ..  |.:.....:|.|||.|.:.|..|.|..   ||.:.:: |||.......:.|  :||     
  Rat   274 ET--LTLPGLVSADNGTYTCEAANKHGHARA---LYVLVVYDPGAVVEAQTSVPYAIVGG----- 328

  Fly   382 RNAGRSNRTTWQPLLAMLMLL 402
                         :||:|:.|
  Rat   329 -------------ILALLVFL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 20/81 (25%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 0/3 (0%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 27/111 (24%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 1/5 (20%)
Ig strand G 231..234 CDD:409562 2/2 (100%)
IG_like 247..355 CDD:214653 19/108 (18%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/4 (0%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 3/4 (75%)
Cadm4NP_001040572.1 Ig 29..120 CDD:472250 22/107 (21%)
Ig strand B 40..44 CDD:409465 1/3 (33%)
Ig strand C 53..57 CDD:409465 1/3 (33%)
Ig strand E 87..91 CDD:409465 0/3 (0%)
Ig strand F 101..106 CDD:409465 2/4 (50%)
Ig strand G 113..116 CDD:409465 1/2 (50%)
IgI_2_Necl-4 121..220 CDD:409468 28/114 (25%)
Ig strand A 121..124 CDD:409468 1/2 (50%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 2/9 (22%)
Ig strand C 152..161 CDD:409468 2/8 (25%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 2/6 (33%)
Ig strand E 177..187 CDD:409468 2/10 (20%)
Ig strand F 195..203 CDD:409468 2/7 (29%)
Ig strand G 212..219 CDD:409468 1/6 (17%)
Ig_3 224..295 CDD:464046 18/101 (18%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.