DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Lac

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:329 Identity:92/329 - (27%)
Similarity:151/329 - (45%) Gaps:43/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CSVRNLGKNKVGWLRA-SDQTVLALQGRVVTHNARISVMHQ-DMHTWKLKISKLRESDRGCYMCQ 122
            |||:...:..|.:|:. ||...|:....:|..::|.|:.:. :..|:||:|..::|:|.|.|.||
  Fly    50 CSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQ 114

  Fly   123 INTSPMKKQVGCIDVQV-PPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILI 186
            :..|.:.|....:.:.| .|.:|::.|:..:...||.:..:.|.|:|.|.|.:|||||:..::  
  Fly   115 VVISTVHKVSAEVKLSV
RRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAIL-- 177

  Fly   187 RKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLL 251
              |...     .:|.|::||:..:::...|.|.|:|.|.|.....:.:::.|:|||::..|...|
  Fly   178 --PTDS-----ATYVGNTLRIKSVKKEDRGTYYCVADN
GVSKGDRRNINVEVEFAPVITVPRPRL 235

  Fly   252 GTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITE--R 314
            |..|..|:.|||.:||.|.|...|.|                     ....|.:...|.|:.  .
  Fly   236 GQALQYDMDLECHIEAYPPPAIVWTK---------------------DDIQLANNQHYSISHFAT 279

  Fly   315 RDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYE--IKLHPGASASNDDHLNYIGGL 377
            .|.|....|.|: :......|.|.|.:||..|.||..:.|:|  |.:.|.|...     .||.|.
  Fly   280 ADEYTDSTLRVI-TVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQ-----AYIAGA 338

  Fly   378 EEAA 381
            |:.:
  Fly   339 EDVS 342

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 23/80 (29%)
Ig 47..129 CDD:299845 22/70 (31%)
Ig 140..238 CDD:299845 26/97 (27%)
IG_like 247..355 CDD:214653 29/109 (27%)
Ig 256..351 CDD:299845 25/96 (26%)
LacNP_523713.2 IG_like 36..131 CDD:214653 23/80 (29%)
FR1 37..50 CDD:409353 92/329 (28%)
Ig strand A' 37..42 CDD:409353