Sequence 1: | NP_651649.1 | Gene: | DIP-gamma / 43417 | FlyBaseID: | FBgn0039617 | Length: | 413 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_940908.3 | Gene: | LRIT3 / 345193 | HGNCID: | 24783 | Length: | 679 | Species: | Homo sapiens |
Alignment Length: | 268 | Identity: | 61/268 - (22%) |
---|---|---|---|
Similarity: | 89/268 - (33%) | Gaps: | 52/268 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 157 GEDATLTCKATGNPQPRVTWRREDGEMI---LIRKPGSRELMKVESYNGSSLRLLRLERRQMGAY 218
Fly 219 LCIASN--DVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGART 281
Fly 282 SNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLG 346
Fly 347 RAEGTLRLYEIKLH----------------PGASASNDDHLNYIGGLEEAARNAGRSNRTTWQPL 395
Fly 396 LAMLMLLW 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-gamma | NP_651649.1 | IG_like | 47..139 | CDD:214653 | |
Ig | 47..129 | CDD:299845 | |||
Ig | 140..238 | CDD:299845 | 26/85 (31%) | ||
IG_like | 247..355 | CDD:214653 | 22/107 (21%) | ||
Ig | 256..351 | CDD:299845 | 20/94 (21%) | ||
LRIT3 | NP_940908.3 | LRR 1 | 56..79 | ||
leucine-rich repeat | 59..82 | CDD:275378 | |||
LRR_8 | 61..117 | CDD:290566 | |||
LRR 2 | 80..103 | ||||
leucine-rich repeat | 83..106 | CDD:275378 | |||
LRR 3 | 104..128 | ||||
LRR_8 | 105..165 | CDD:290566 | |||
LRR_4 | 105..146 | CDD:289563 | |||
leucine-rich repeat | 107..130 | CDD:275378 | |||
LRR 4 | 129..151 | ||||
LRR_4 | 131..170 | CDD:289563 | |||
leucine-rich repeat | 131..154 | CDD:275378 | |||
LRR 5 | 152..175 | ||||
leucine-rich repeat | 155..168 | CDD:275378 | |||
Ig | 267..345 | CDD:299845 | 25/82 (30%) | ||
IG_like | 267..345 | CDD:214653 | 25/82 (30%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 351..375 | 6/23 (26%) | |||
FN3 | 486..550 | CDD:214495 | 3/19 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |