DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr19

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:326 Identity:82/326 - (25%)
Similarity:122/326 - (37%) Gaps:90/326 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQSTLFVILIMATKCGSGS-TQNQHHESS---SQLDPDPEFIGFINN--VTYPAGREAILACSVR 63
            |..:.|::|:.:|....|. |.:|:|..:   ||.:..       ||  |....|..|||.|.|:
  Fly     8 LHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTK-------NNTRVIAQKGGLAILPCVVK 65

  Fly    64 NLGKNKVGWLRASDQTVLALQGRVVTHNA--RISVMH-QDMHTWKLKISKLRESDRGCYMCQINT 125
            ......|.|:|..|..:|.:  .:.||::  |..|.| :.|..|.|:|..:||.|||.|.||::.
  Fly    66 VNSPATVSWIRRKDFQLLTV--GLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSI 128

  Fly   126 SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCK---ATGNPQPRVTWRREDGEMILIR 187
            .|.:..|  |::::...:....|:.:|.:.|.....|.||   ||.|| ..|.| ..|.:||...
  Fly   129 YPTQSIV--IELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP-AFVFW-YHDSKMINYD 189

  Fly   188 KPG-------------------------SRELMKVESYNG------------------------- 202
            ..|                         ||..|.:||.||                         
  Fly   190 SQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPY 254

  Fly   203 ---------------SSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLG 252
                           |.|.:.::..|..|.|.|..||..|.:::..|....:.|.|..|...:|.
  Fly   255 MTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILD 319

  Fly   253 T 253
            |
  Fly   320 T 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 31/86 (36%)
Ig strand B 56..60 CDD:409353 3/3 (100%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 33/164 (20%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 2/7 (29%)
Ig strand B 259..263 CDD:409358
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
dpr19NP_609392.1 IG_like 50..127 CDD:214653 29/78 (37%)
Ig strand B 58..62 CDD:409353 3/3 (100%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 9/32 (28%)
Ig strand E 270..274 CDD:409551 2/3 (67%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.