DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and DIP-eta

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:382 Identity:154/382 - (40%)
Similarity:224/382 - (58%) Gaps:44/382 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STLFVILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVG 71
            |.:.::::|:.:|     ..|..|..:::..||:|...|.|:|.|.||:|.|.|.|::||..||.
  Fly    16 SVILLLILMSQQC-----YPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVA 75

  Fly    72 WLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCID 136
            |||...||:|.:|..|:|.|.||.:.:.:..||.::|..::|||:|.|||||||.|||.|:|.:|
  Fly    76 WLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLD 140

  Fly   137 VQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYN 201
            |.|||||::..:|.|:.|:||.:.||.|.|||:|:|.:|||||.|  :.|......|:|.:|   
  Fly   141 VVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESG--VPIELATGEEVMSIE--- 200

  Fly   202 GSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVE 266
            |:.|.:..:.|..||||||||||.|||:||||::|.|.|.||:...:||:|...|..|.|:|:.|
  Fly   201 GTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESE 265

  Fly   267 ASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKY--GITERRDGYRGVMLLVVRSF 329
            |.|..::||.:                |.|    |::..|.||  .:|| ..|||..|.|.:...
  Fly   266 AYPKSINYWTR----------------ERG----EIVPPGGKYSANVTE-IGGYRNSMRLHINPL 309

  Fly   330 SPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASASNDDHLNYIGGLEEAARNAGR 386
            :.::.|:|.||:.||||..:||::||.|.  |.|       :||:...|  ||:.|:
  Fly   310 TQAEFGSYRCVAKNSLGDTDGTIKLYRIP--PNA-------VNYVENFE--ARHKGK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 40/81 (49%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 2/3 (67%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 3/4 (75%)
Ig 141..238 CDD:472250 47/96 (49%)
Ig strand B 160..164 CDD:409562 2/3 (67%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 4/4 (100%)
Ig strand G 231..234 CDD:409562 2/2 (100%)
IG_like 247..355 CDD:214653 35/109 (32%)
Ig strand B 259..263 CDD:409358 2/3 (67%)
Ig strand C 272..276 CDD:409358 1/3 (33%)
Ig strand E 317..326 CDD:409358 5/8 (63%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 43/85 (51%)
Ig strand B 60..64 CDD:409353 2/3 (67%)
Ig strand C 73..77 CDD:409353 2/3 (67%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
IgI_1_MuSK 145..237 CDD:409562 47/96 (49%)
Ig strand A 145..148 CDD:409562 2/2 (100%)
Ig strand A' 153..158 CDD:409562 2/4 (50%)
Ig strand B 164..171 CDD:409562 3/6 (50%)
Ig strand C 177..182 CDD:409562 2/4 (50%)
Ig strand C' 184..186 CDD:409562 1/3 (33%)
Ig strand D 194..197 CDD:409562 1/2 (50%)
Ig strand E 202..208 CDD:409562 1/5 (20%)
Ig strand F 215..222 CDD:409562 6/6 (100%)
Ig strand G 229..237 CDD:409562 5/7 (71%)
IG_like 252..335 CDD:214653 32/103 (31%)
Ig strand B 258..262 CDD:409353 2/3 (67%)
Ig strand C 271..282 CDD:409353 5/30 (17%)
Ig strand E 301..306 CDD:409353 2/4 (50%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.