DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and fipi

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:356 Identity:78/356 - (21%)
Similarity:126/356 - (35%) Gaps:99/356 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTV----LALQGRVV 88
            ||||.|....:...:.:.|       ...|:.|             |:.|..|    .:.:|.::
  Fly    21 HHESLSLSPAEHSVVRYTN-------ESLIVQC-------------RSPDPKVELHWKSPKGEII 65

  Fly    89 -THNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADL 152
             .|..||.:........|:..:.:..:|:|.:.|:.....:..:  ..|:.|...|...|::..:
  Fly    66 REHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSK--SFDLIVYQKITFTENATVM 128

  Fly   153 AVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLL-------RL 210
            .|:|||.||:.|:..|.|||.||| ..:|:.|           ...:.:.|..|:|       ::
  Fly   129 TVKEGEKATILCEVKGEPQPNVTW-HFNGQPI-----------SAGAADDSKFRILADGLLINKV 181

  Fly   211 ERRQMGAYLC-------IASN----------DVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSD 258
            .:...|.|.|       |||:          :..|..||...:|:::|       .:.||     
  Fly   182 TQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYA-------YINGT----- 234

  Fly   259 VQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVML 323
            ..|.|:..|.|.....|.   |..|...|.:..                   .|.:.|.|...:.
  Fly   235 ATLMCEALAEPPANFTWY---RKHNKLHSNNRL-------------------YTIQSDSYWSSLT 277

  Fly   324 LVVRSFSPSDVGTYHCVSTNSLGRAEGTLRL 354
            :.|.:.|..|  .|.|.:.|.||..|.|.||
  Fly   278 IHVLNTSAFD--NYRCRARNDLGTIERTTRL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 14/96 (15%)
Ig 47..129 CDD:299845 13/86 (15%)
Ig 140..238 CDD:299845 30/121 (25%)
IG_like 247..355 CDD:214653 25/108 (23%)
Ig 256..351 CDD:299845 20/94 (21%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 15/103 (15%)
I-set 128..202 CDD:254352 24/85 (28%)
Ig 133..>193 CDD:299845 20/71 (28%)
IG_like 228..307 CDD:214653 26/115 (23%)
Ig 235..305 CDD:143165 21/93 (23%)
FN3 312..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.