DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and bdl

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:462 Identity:91/462 - (19%)
Similarity:152/462 - (32%) Gaps:153/462 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQSTLFVILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSV------- 62
            |.:.|.:||:|...|.|.:..::..                .|:....|...:..|.:       
  Fly    16 LLALLAIILLMNISCTSAARDHRRQ----------------TNLEAKVGSHVVFNCYIDFPFDAP 64

  Fly    63 -------RNLGKNKVGWLRASDQTVLALQGRV-VTHNARISVMHQDMHTWKLKISKLRESDRGCY 119
                   ....|....|......|.....||: :..|      |.:.....:.::.:||||:|.|
  Fly    65 IPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVEN------HPEFGRASVNLTAIRESDQGWY 123

  Fly   120 MCQI---NTSP----------MKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQ 171
            .||:   |.||          :..|.|.: :::||  :|:      .::||:.|...|.......
  Fly   124 HCQVSFPNRSPSVRNNGTAYHLAVQGGSL-IRIPP--VNQ------TIREGQTAFFHCVMKHPEN 179

  Fly   172 PRVTWRREDGEMI-----LIRKPGSRELMKVESYNG--SSLRLLRLERRQMGAYLCIASNDVPPA 229
            .:.:|.: ||.::     |:|:          .|.|  .||.:.......:|.|.|...|.....
  Fly   180 SQASWYK-DGVLLQEVQDLVRR----------FYMGPDGSLSIDPTMMSDLGEYECKVRNSDGEL 233

  Fly   230 VSKRVSLSVQF-APMVRAPSQLLGTPLGSDVQLECQVEASPSPV-------------SYWLKGA- 279
            .:.:..|::|: |.::.||.::. .|.|....|:|...|:| |:             ||.:.|. 
  Fly   234 QTAKAFLNIQYKAKVIYAPPEVF-LPYGQPAVLDCHFRANP-PLKNLRWEKDGLLFDSYNVPGVF 296

  Fly   280 RTSNG---FASVS---------TASLESGSPGPE-----MLLDGPKYGITER------------- 314
            ...||   ||.|.         |...:.|:.||.     ::|..|.:.:|.:             
  Fly   297 YKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAEL 361

  Fly   315 ------RDGYRGVML---------------------LVVRSFSPSDVGTYHCVSTNSLG--RAEG 350
                  |||.....:                     |.:......|.|.|.|.:||...  .||.
  Fly   362 PCEAIDRDGNNRPSIIWGRKDGQPLPADRFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEA 426

  Fly   351 TLRLYEI 357
            .|.:..|
  Fly   427 ELMIENI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 23/119 (19%)
Ig 47..129 CDD:299845 21/109 (19%)
Ig 140..238 CDD:299845 21/104 (20%)
IG_like 247..355 CDD:214653 36/180 (20%)
Ig 256..351 CDD:299845 33/167 (20%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 18/91 (20%)
Ig 43..131 CDD:299845 17/93 (18%)
I-set 153..242 CDD:254352 21/107 (20%)
Ig 157..242 CDD:299845 20/103 (19%)
Ig_2 252..337 CDD:290606 20/86 (23%)
IG_like 260..327 CDD:214653 16/67 (24%)
I-set 341..428 CDD:254352 14/86 (16%)
IGc2 356..419 CDD:197706 10/62 (16%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.