DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr2

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:389 Identity:98/389 - (25%)
Similarity:139/389 - (35%) Gaps:105/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GSTQNQHHESSSQ-----LDPDPEF-IGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTV 80
            |::.:...|:..|     ..|.|.| .|...|:|...|..|.:.|.|.|||...|.|:|..|..:
  Fly    84 GNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHI 148

  Fly    81 LALQGRVVTHNARISVMH-QDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQV-PPD- 142
            |.......|.:.|..|:. .|...|.|.:...:..|.|.|.||:||.|.......::|.| ||| 
  Fly   149 LTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDA 213

  Fly   143 --IINEESSADLAVQEGEDATLTCKATGNPQPR--------VTWRREDGEMIL---IRKPGSREL 194
              ||  ....||.|:.|...||||..   .||.        :.|.|  |..||   :..|....:
  Fly   214 KAII--AGPTDLYVKVGSSVTLTCHV---KQPATSAQDIGPIYWYR--GPYILTPFVAHPNDAAI 271

  Fly   195 ----MKVESYNGSSLR-LLRLERRQM---GAYLCIAS------------NDVPPAVSKRVSLSVQ 239
                :.:||.....|: .||:...|:   |.|.|:.:            ||..||       ::|
  Fly   272 DLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPA-------AMQ 329

  Fly   240 FAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLL 304
            .:..:|....:..:.|   |.|...|.:|   |..||.|                          
  Fly   330 KSRAIRTSGSMRSSRL---VLLLAMVASS---VVRWLIG-------------------------- 362

  Fly   305 DGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIK-LHPGASASN 367
             |.:.|.....|             |.|::.|.|....|.  ||:.|..|.|.: |.||::..:
  Fly   363 -GQRIGSNSCHD-------------SCSNLSTLHINYCNL--RAKITSHLKEHRCLGPGSTVES 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 28/82 (34%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 33/130 (25%)
Ig strand B 160..164 CDD:409562 2/3 (67%)
Ig strand C 173..177 CDD:409562 0/11 (0%)
Ig strand E 203..207 CDD:409562 1/4 (25%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 20/107 (19%)
Ig strand B 259..263 CDD:409358 2/3 (67%)
Ig strand C 272..276 CDD:409358 1/3 (33%)
Ig strand E 317..326 CDD:409358 0/8 (0%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/92 (30%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 4/5 (80%)
FR2 137..151 CDD:409355 5/13 (38%)
Ig strand C 137..143 CDD:409355 2/5 (40%)
Ig strand C' 149..153 CDD:409355 1/3 (33%)
CDR2 153..162 CDD:409355 1/8 (13%)
Ig strand D 162..167 CDD:409355 1/4 (25%)
FR3 163..192 CDD:409355 8/28 (29%)
Ig strand E 172..178 CDD:409355 2/5 (40%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 24/90 (27%)
Ig strand B 231..235 CDD:409353 2/3 (67%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 2/4 (50%)
Ig strand G 310..313 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.