DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr3

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:266 Identity:65/266 - (24%)
Similarity:103/266 - (38%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KCGSGSTQNQHHESSSQLDPDPEF-IGFINNVTYPAGR-EAILACSVRNLGKNKVGWLRASDQTV 80
            :.|:...::|..::|..|   |.| .|...|:|...|. |||:.|.|.:|....|.|:|..|..:
  Fly   218 RSGAADEESQDADTSQSL---PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHI 279

  Fly    81 LALQGRVVTHNARISVMH-QDMHTWKLKISKLRESDRGCYMCQINTSP---MKKQVGCIDVQVPP 141
            |.:.....|.:.|..|.. :|...|.|.:......|.|.|.||:||.|   |..|:..|::.  |
  Fly   280 LTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEIS--P 342

  Fly   142 D---IINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGS 203
            |   :|:  ...||..:.|....|.|                    |:::|..:::..:..|.|.
  Fly   343 DAKAVIS--GPPDLHFKAGSAIILNC--------------------LVQQPSVKDIGPIYWYRGE 385

  Fly   204 -------------SLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPL 255
                         .:...|.|..|     .|..:..|..:...|.|.::||..:...|| ||..|
  Fly   386 HMITPFDADDGQPEIPAGRGEHPQ-----GIPEDTSPNDIMSEVDLQMEFATRIAMESQ-LGDTL 444

  Fly   256 GSDVQL 261
            .|.:::
  Fly   445 KSRLRI 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 31/96 (32%)
Ig 47..129 CDD:299845 28/86 (33%)
Ig 140..238 CDD:299845 19/113 (17%)
IG_like 247..355 CDD:214653 6/15 (40%)
Ig 256..351 CDD:299845 1/6 (17%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 28/86 (33%)
IG_like 243..329 CDD:214653 28/85 (33%)
Ig 350..464 CDD:299845 24/127 (19%)
IG_like <441..477 CDD:214653 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.